Property Summary

NCBI Gene PubMed Count 22
PubMed Score 167.45
PubTator Score 54.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.000 3.1e-03
astrocytic glioma -1.400 1.2e-03
Astrocytoma, Pilocytic -1.600 7.2e-04
atypical teratoid/rhabdoid tumor -1.200 4.1e-02
ependymoma -1.200 3.8e-03
glioblastoma -1.800 2.1e-06
group 3 medulloblastoma -2.000 2.8e-02
lung carcinoma 1.700 2.8e-15
medulloblastoma, large-cell -2.100 7.5e-04
oligodendroglioma -1.200 9.7e-13
primitive neuroectodermal tumor -1.200 1.9e-02

Gene RIF (13)

AA Sequence

MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLD      1 - 70
ILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGN     71 - 140
KNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGD    141 - 210
AFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ                  211 - 266
//

Text Mined References (23)

PMID Year Title