Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.68
PubTator Score 14.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.300 3.9e-02
psoriasis -1.400 7.5e-04
osteosarcoma 2.865 1.5e-08
cystic fibrosis 1.060 2.6e-04
medulloblastoma, large-cell -1.200 2.4e-04
primitive neuroectodermal tumor 1.300 6.0e-04
Duchenne muscular dystrophy 1.024 3.8e-04
juvenile dermatomyositis 1.536 1.1e-10
pancreatic ductal adenocarcinoma liver m... 1.568 1.0e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
Pick disease 1.200 2.9e-04
gastric carcinoma 1.100 5.2e-03
ulcerative colitis 1.100 4.9e-06
Gaucher disease type 1 -1.300 3.9e-02
pancreatic cancer 1.300 1.4e-02

Protein-protein Interaction (6)

Gene RIF (2)

PMID Text
26502337 Recurrent inactivating RASA2 mutations are associated with melanoma.
10074452 GAP1m is a Ras GAP that switches off Ras signalling. GAP1m undergoes a plasma membrane association following growth factor stimulation of PI 3-kinase as a result of its PH domain binding to phosphatidylinositol 3,4,5-trisphosphate.

AA Sequence

MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMRDCFCTINLDQ      1 - 70
EEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGKVAIKKEDLCNHSGKETWFSL     71 - 140
QPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKT    141 - 210
KVKKKTSNPQFNEIFYFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLR    211 - 280
TDSSHQAWYLLQPRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYIL    281 - 350
SEICRDKNDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV    351 - 420
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCDIFYSLRQMAT    421 - 490
QRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLISKTIQTLGSWGSLSKSKSS    491 - 560
FKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRW    561 - 630
FCLTSRELTYHKQPGSKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDV    631 - 700
LCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSL    701 - 770
LKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS    771 - 840
KENPIVGKAS                                                                841 - 850
//

Text Mined References (13)

PMID Year Title
26502337 2015 Recurrent inactivating RASA2 mutations in melanoma.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10074452 1999 Identification of the ras GTPase-activating protein GAP1(m) as a phosphatidylinositol-3,4,5-trisphosphate-binding protein in vivo.
9382842 1997 Distinct subcellular localisations of the putative inositol 1,3,4,5-tetrakisphosphate receptors GAP1IP4BP and GAP1m result from the GAP1IP4BP PH domain directing plasma membrane targeting.
8917095 1996 Human rasGTPase-activating protein (human counterpart of GAP1m): sequence of the cDNA, primary structure of the protein, production and chromosomal localization.
8812506 1996 cDNA cloning and chromosomal mapping of a novel human GAP (GAP1M), a GTPase-activating protein of Ras.
8699317 1996 [Heterogeneity of GTPase-activating proteins for Ras in the regulation of Ras signal transduction pathway].