Property Summary

NCBI Gene PubMed Count 175
PubMed Score 375.11
PubTator Score 334.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
chronic lymphocytic leukemia 1.312 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.700 6.6e-03
lung cancer -1.900 7.2e-05
group 4 medulloblastoma 1.100 2.1e-02
lung adenocarcinoma 1.071 6.7e-06
Pick disease -1.300 9.4e-04
Breast cancer -1.200 7.1e-08
ovarian cancer -2.300 7.8e-10

Gene RIF (64)

PMID Text
26840794 PTP1B dephosphorylates PITX1 to weaken its protein stability and the transcriptional activity for p120RasGAP gene expression
26710849 Data suggest that, in response to netrin-1/netrin receptor (DCC) signaling, p120RasGAP is recruited to growth cones and supports axon outgrowth; p120RasGAP Src homology 2 domains exhibit scaffolding properties sufficient to support axon outgrowth.
26192947 This is the second largest study on isolated, non-syndromic Port-wine stain; data suggest that GNAQ is the main genetic determinant in this condition. Moreover, isolated port-wine stains are distinct from capillary malformations seen in RASA1 disorders.
26126858 Data showed that hypoxia regulated the expression of miR-182 and RASA1 to promote HCC angiogenesis.
26109071 p120RasGAP shields Akt from deactivating phosphatases in FGF1 signaling, but loses this ability once cleaved by caspase-3.
26096958 Maternal and fetal capillary malformation-arteriovenous malformation due to a novel RASA1 mutation presenting with prenatal non-immune hydrops fetalis have been found.
25867276 Low RASA1 expression is associated with colorectal cancer.
25733681 Results show that report that RasGAP associates to PDGFRbeta and prevents its direct activation. This underlying mechanism raises the possibility that PDGFRbeta-mediated diseases involve indirect activation of PDGFRbeta.
25663768 miR-21 promotes malignant behaviors of colon cancer cells by regulating RASA1 expression via RAS pathways.
25394563 RASA1 expression is associated with breast cancer progression and poor survival and diseasefree survival of patients.
25246356 The individual contribution of each Akt isoform in p120 RasGAP fragment N-mediated cell protection against Fas ligand induced cell death, was investigated.
25202123 Antisense-mediated knockdown (anti-miR) revealed that miR-206/21 coordinately promote RAS-ERK signaling and the corresponding cell phenotypes by inhibiting translation of the pathway suppressors RASA1 and SPRED1.
25040287 Capillary malformation-arteriovenous malformation syndrome (CM-AVM) is an autosomal dominant disorder caused by RASA1 mutations.
24600991 our study reveals mir-182 suppresses cell proliferation in vivo. RASA1 is related to cell apoptosis. We further show that mir-182 downregulates RASA1
24465899 A ubiquitous binding partner of p190RhoGAP, p120RasGAP (RasGAP), is expressed in much lower levels in DKO4 cells compared to DLD1, and this expression is regulated by KRAS.
24443565 The novel findings of this study shed light on the molecular mechanisms underlying the DLC1 inhibitory effects of p120 and suggest a functional cross-talk between Ras and Rho proteins at the level of regulatory proteins.
24347041 These results indicate that stress-activated caspase-3 might contribute to the suppression of metastasis through the generation of fragment N2( RasGAP
24038909 RASA1 mutations specifically cause capillary malformation-arteriovenous malformation.
23829194 Multifocal, small, round-to-oval, pinkish-to-red cutaneous capillary malformations are seen in more than 90% of people with RASA1 mutations.
23650393 RASA1 mutation is responsible for the aberrant lymphatic architecture and functional abnormalities, as visualized in the PKWS subject and in the animal model.
23447049 The results of the present study indicate that P110, in combination with chemotherapeutics, is likely to represent a potential therapeutic strategy for cancer.
23386617 14-3-3 negatively regulates the RGC downstream of the PI3-kinase/Akt signaling pathway
23322774 MicroRNA-31 activates the RAS pathway and functions as an oncogenic MicroRNA by repressing RAS p21 GTPase activating protein 1 (RASA1)
23158644 capillary malformation-arteriovenous malformation syndrome; study reports a family with a novel mutation in the RASA1 gene - a truncating mutation in exon 11 of RASA1 (Q503X)
22949691 Ras and GTPase-activating protein (GAP) drive GTP into a precatalytic state as revealed by combining FTIR and biomolecular simulations
22342634 An update of the associated phenotype variability in a family with hereditary capillary malformations caused by a mutation in the RASA1 gene.
22205990 arguments against G3BP1 being a genuine RasGAP-binding partner
22200646 multifocal capillary malformations is the key clinical finding to suggest a RASA1 mutation
21768288 The results assign an unexpected role for p120RasGAP in the regulation of integrin traffic in cancer cells and reveal a new concept of competitive binding of Rab GTPases and GAP proteins to receptors as a regulatory mechanism in trafficking.
21664272 Cell adhesion to the substrate is necessary for RasGAP to bind Nck1. Cell detachment makes RasGAP incapable of associating with Nck1 and decreases RasGAP activity.
21664272 Nck1 activates RasGAP by direct binding in the substrate-attached but not in the suspended cells.
21646295 An important role is revealed for p120 RasGAP (RASA1) as a transgenic regulator of CD4+CD8+ double-positive cell survival and positive selection in the thymus as well as naive T cell survival in the periphery.
21460216 Ca2+-dependent monomer and dimer formation switches CAPRI Protein between Ras GTPase-activating protein (GAP) and RapGAP activities
21368895 Ras mutation cooperates with beta-catenin activation to drive bladder tumourigenesis.
20821215 A novel synonymous mutation (c.1229 G > A [p.K420K]) of RASA1 was identified in a Chinese population with sporadic Sturge-Weber syndrome
20702649 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20688547 Observational study of gene-disease association. (HuGE Navigator)
20676106 miR-132 acts as an angiogenic switch by suppressing endothelial p120RasGAP expression.
20610402 Sema4D/Plexin-B1 promotes the dephosphorylation and activation of PTEN through the R-Ras GAP activity, inducing growth cone collapse.
20592250 Observational study of gene-disease association. (HuGE Navigator)
20007727 In a collaborative study, 5 index patients (2 females, 3 males) with spinal AVMs or AVFs and cutaneous multifocal capillary lesions were investigated for the RASA1 gene mutation.
19843518 the monomeric intracellular plexin-B1 binds R-Ras but not H-Ras. These findings suggest that the monomeric form of the intracellular region is primed for GAP activity and extend a model for plexin activation.
19786546 CD200R inhibits the activation of human myeloid cells through direct recruitment of Dok2 and subsequent activation of RAS p21 protein activator 1.
19773259 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19578876 Observational study of gene-disease association. (HuGE Navigator)
19435801 Data show that fibroblast, endothelial and carcinoma polarity during cell migration requires FAK and is associated with a complex between FAK, p120RasGAP and p190RhoGAP (p190A), leading to p190A tyrosine phosphorylation.
19151751 p120Ras-GAP binds the DLC1 Rho-GAP tumor suppressor protein and inhibits its RhoA GTPase and growth-suppressing activities.
19012001 Observational study of gene-disease association. (HuGE Navigator)
18784923 found a mean Ras activation of 23.1% in cell lines with known constitutively activating ras mutations
18761085 RasGAP and Capns1 interaction in oncogenic Ras cells is involved in regulating migration and cell survival.
18446851 42 novel RASA1 mutations and the associated phenotype in 44 families.
18363760 the spectrum of clinical manifestations due to mutations in RASA1 is wider than previously thought and also includes typical CMs not associated with AVM/AVF.
18327598 novel mutation is decribed, which causes capillary malformation and limb enlargement in a patient from a family with vascular malformations
18024870 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16971514 These results demonstrate that integrin signaling through Arg activates p190 by promoting its association with p120, resulting in recruitment of p190 to the cell periphery where it inhibits Rho.
16046410 an uncleavable N-terminal RasGAP fragment in insulin-secreting cells has a role in increasing resistance toward apoptotic stimuli without affecting glucose-induced insulin secretion
15688026 p52Shc couples tyrosine kinase receptors to Ras by recruiting Grb2/Sos complexes.
15542850 executioner caspases control the extent of their own activation by a feedback regulatory mechanism initiated by the partial cleavage of RasGAP that is crucial for cell survival under adverse conditions
15187129 ligation of CD40 on EC increased association of Ras with its effector molecules Raf, Rho, and PI3K. But, it was determined that only PI3K was functional for Ras-induced VEGF transcription.
15041706 The induction of p21 gene expression is mediated by PPARgamma ligands in lung carcinoma.
15010862 p21Ras, hSOS1, and p120GAP are not involved in polycystic ovary disease
12730209 mutual regulation of Ras and NF1-GAP is essential for normal neuronal differentiation
11847220 N-terminal fragment generated by caspase cleavage protects cells in a Ras/PI3K/Akt-dependent manner that does not rely on NFkappa B activation
11751853 We show a novel alternative pathway of apoptosis in human primary cells that is mediated by transcriptionally dependent decreases in p53 and c-Myc and decreases in p21.

AA Sequence

MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGTLGGGAALGSE      1 - 70
FLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLPTSLLAETLGPGGGFPPLPPP     71 - 140
PYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKSGSYLIRESD    141 - 210
RRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVED    211 - 280
RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKI    281 - 350
WFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG    351 - 420
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRW    421 - 490
KNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGE    491 - 560
TPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHA    561 - 630
REGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKG    631 - 700
IEPGSLRVRARYSMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLL    701 - 770
CTLNDREISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED    771 - 840
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLICPAIL    841 - 910
NPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIMFLDELGNVPEL    911 - 980
PDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQKQNQYTKTNDVR       981 - 1047
//

Text Mined References (184)

PMID Year Title
26840794 2016 Protein tyrosine phosphatase 1B dephosphorylates PITX1 and regulates p120RasGAP in hepatocellular carcinoma.
26710849 2016 p120RasGAP Protein Mediates Netrin-1 Protein-induced Cortical Axon Outgrowth and Guidance.
26192947 2015 Genetic Variants Associated with Port-Wine Stains.
26126858 2015 Hypoxia-inducible MiR-182 promotes angiogenesis by targeting RASA1 in hepatocellular carcinoma.
26109071 2015 RasGAP Shields Akt from Deactivating Phosphatases in Fibroblast Growth Factor Signaling but Loses This Ability Once Cleaved by Caspase-3.
26096958 2015 Maternal and fetal capillary malformation-arteriovenous malformation (CM-AVM) due to a novel RASA1 mutation presenting with prenatal non-immune hydrops fetalis.
25867276 2015 C/EBP-?-activated microRNA-223 promotes tumour growth through targeting RASA1 in human colorectal cancer.
25733681 2015 RasGAP Promotes Autophagy and Thereby Suppresses Platelet-Derived Growth Factor Receptor-Mediated Signaling Events, Cellular Responses, and Pathology.
25663768 2015 MiR-21/RASA1 axis affects malignancy of colon cancer cells via RAS pathways.
25394563 2015 Downregulation of Ras GTPase?activating protein 1 is associated with poor survival of breast invasive ductal carcinoma patients.
25246356 2014 The activity of the anti-apoptotic fragment generated by the caspase-3/p120 RasGAP stress-sensing module displays strict Akt isoform specificity.
25202123 2014 MicroRNAs 206 and 21 cooperate to promote RAS-extracellular signal-regulated kinase signaling by suppressing the translation of RASA1 and SPRED1.
25040287 Clinical spectrum of capillary malformation-arteriovenous malformation syndrome presenting to a pediatric dermatology practice: a retrospective study.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24600991 2014 Hsa-mir-182 downregulates RASA1 and suppresses lung squamous cell carcinoma cell proliferation.
24465899 2014 p120RasGAP is a mediator of rho pathway activation and tumorigenicity in the DLD1 colorectal cancer cell line.
24443565 2014 Functional cross-talk between ras and rho pathways: a Ras-specific GTPase-activating protein (p120RasGAP) competitively inhibits the RhoGAP activity of deleted in liver cancer (DLC) tumor suppressor by masking the catalytic arginine finger.
24412244 2014 Charting the molecular links between driver and susceptibility genes in colorectal cancer.
24347041 2014 Fragment N2, a caspase-3-generated RasGAP fragment, inhibits breast cancer metastatic progression.
24038909 2013 RASA1 mutations and associated phenotypes in 68 families with capillary malformation-arteriovenous malformation.
23829194 Histopathologic and ultrasound characteristics of cutaneous capillary malformations in a patient with capillary malformation-arteriovenous malformation syndrome.
23687085 2013 A novel RASA1 mutation causing capillary malformation-arteriovenous malformation (CM-AVM) presenting during pregnancy.
23650393 2013 Lymphatic abnormalities are associated with RASA1 gene mutations in mouse and man.
23447049 2013 Growth inhibition effect of peptide P110 plus cisplatin on various cancer cells and xenotransplanted tumors in mice.
23386617 2013 Negative regulation of the RalGAP complex by 14-3-3.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23322774 2013 MicroRNA-31 activates the RAS pathway and functions as an oncogenic MicroRNA in human colorectal cancer by repressing RAS p21 GTPase activating protein 1 (RASA1).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158644 2012 Capillary malformation-arteriovenous malformation syndrome: identification of a family with a novel mutation.
22949691 2012 Ras and GTPase-activating protein (GAP) drive GTP into a precatalytic state as revealed by combining FTIR and biomolecular simulations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22342634 2012 Phenotypic variability in a family with capillary malformations caused by a mutation in the RASA1 gene.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22205990 2011 Revisiting G3BP1 as a RasGAP binding protein: sensitization of tumor cells to chemotherapy by the RasGAP 317-326 sequence does not involve G3BP1.
22200646 2012 RASA1 analysis: clinical and molecular findings in a series of consecutive cases.
21768288 2011 Competitive binding of Rab21 and p120RasGAP to integrins regulates receptor traffic and migration.
21664272 2011 Adaptor protein Nck1 interacts with p120 Ras GTPase-activating protein and regulates its activity.
21646295 2011 A role for p120 RasGAP in thymocyte positive selection and survival of naive T cells.
21460216 2011 Ca2+-dependent monomer and dimer formation switches CAPRI Protein between Ras GTPase-activating protein (GAP) and RapGAP activities.
21368895 2011 Ras mutation cooperates with ?-catenin activation to drive bladder tumourigenesis.
21269460 2011 Initial characterization of the human central proteome.
21173776 2012 Meta-analysis of genome-wide association studies for personality.
20821215 2011 Detection of RASA1 mutations in patients with sporadic Sturge-Weber syndrome.
20702649 2010 Identification of several novel non-p.R132 IDH1 variants in thyroid carcinomas.
20688547 2010 Backtracking RAS mutations in high hyperdiploid childhood acute lymphoblastic leukemia.
20676106 2010 MicroRNA-132-mediated loss of p120RasGAP activates the endothelium to facilitate pathological angiogenesis.
20610402 2010 Semaphorin 4D/Plexin-B1 stimulates PTEN activity through R-Ras GTPase-activating protein activity, inducing growth cone collapse in hippocampal neurons.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20592250 2010 High-frequency type I/II mutational shifts between diagnosis and relapse are associated with outcome in pediatric AML: implications for personalized medicine.
20007727 2010 A novel association between RASA1 mutations and spinal arteriovenous anomalies.
19843518 2009 Structure and function of the intracellular region of the plexin-b1 transmembrane receptor.
19786546 2009 Essential roles for Dok2 and RasGAP in CD200 receptor-mediated regulation of human myeloid cells.
19773259 2009 Genome wide molecular analysis of minimally differentiated acute myeloid leukemia.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19435801 2009 A FAK-p120RasGAP-p190RhoGAP complex regulates polarity in migrating cells.
19151751 2009 p120Ras-GAP binds the DLC1 Rho-GAP tumor suppressor protein and inhibits its RhoA GTPase and growth-suppressing activities.
19012001 2009 PIK3CA mutation occurs in nasopharyngeal carcinoma but does not significantly influence the disease-specific survival.
18784923 2009 Determination of Ras-GTP and Ras-GDP in patients with acute myelogenous leukemia (AML), myeloproliferative syndrome (MPS), juvenile myelomonocytic leukemia (JMML), acute lymphocytic leukemia (ALL), and malignant lymphoma: assessment of mutational and indirect activation.
18761085 2008 Capns1, a new binding partner of RasGAP-SH3 domain in K-Ras(V12) oncogenic cells: modulation of cell survival and migration.
18446851 2008 Parkes Weber syndrome, vein of Galen aneurysmal malformation, and other fast-flow vascular anomalies are caused by RASA1 mutations.
18363760 2008 RASA1 mutations may cause hereditary capillary malformations without arteriovenous malformations.
18327598 2008 A novel mutation in RASA1 causes capillary malformation and limb enlargement.
18024870 2007 Prognostic and predictive importance of p53 and RAS for adjuvant chemotherapy in non small-cell lung cancer.
18024423 2008 Regulation of 3-phosphoinositide-dependent protein kinase-1 (PDK1) by Src involves tyrosine phosphorylation of PDK1 and Src homology 2 domain binding.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16971514 2006 Integrin signaling through Arg activates p190RhoGAP by promoting its binding to p120RasGAP and recruitment to the membrane.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16051609 2005 EphrinA1 repulsive response is regulated by an EphA2 tyrosine phosphatase.
16046410 2005 Expression of an uncleavable N-terminal RasGAP fragment in insulin-secreting cells increases their resistance toward apoptotic stimuli without affecting their glucose-induced insulin secretion.
15917201 2005 RASA1: variable phenotype with capillary and arteriovenous malformations.
15713673 2005 The SPRY domain-containing SOCS box protein 1 (SSB-1) interacts with MET and enhances the hepatocyte growth factor-induced Erk-Elk-1-serum response element pathway.
15688026 2005 Cooperation and selectivity of the two Grb2 binding sites of p52Shc in T-cell antigen receptor signaling to Ras family GTPases and Myc-dependent survival.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15574420 2005 A novel role for Gab1 and SHP2 in epidermal growth factor-induced Ras activation.
15542850 2004 Partial cleavage of RasGAP by caspases is required for cell survival in mild stress conditions.
15504032 2004 Tyrosine phosphorylation of caveolin-2 at residue 27: differences in the spatial and temporal behavior of phospho-Cav-2 (pY19 and pY27).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15187129 2004 The CD40-induced signaling pathway in endothelial cells resulting in the overexpression of vascular endothelial growth factor involves Ras and phosphatidylinositol 3-kinase.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15077193 2004 Overexpression of FAK promotes Ras activity through the formation of a FAK/p120RasGAP complex in malignant astrocytoma cells.
15041706 2004 Up-regulation of p21 gene expression by peroxisome proliferator-activated receptor gamma in human lung carcinoma cells.
15010862 2004 Normal p21Ras/MAP kinase pathway expression and function in PBMC from patients with polycystic ovary disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14639529 2003 Capillary malformation-arteriovenous malformation, a new clinical and genetic disorder caused by RASA1 mutations.
12730241 2003 Two new substrates in insulin signaling, IRS5/DOK4 and IRS6/DOK5.
12730209 2003 Neurofibromatosis type I tumor suppressor neurofibromin regulates neuronal differentiation via its GTPase-activating protein function toward Ras.
12679785 2003 Transgenic RNA interference in ES cell-derived embryos recapitulates a genetic null phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441060 2002 Fear memory formation involves p190 RhoGAP and ROCK proteins through a GRB2-mediated complex.
12112020 2002 Sam68 associates with the SH3 domains of Grb2 recruiting GAP to the Grb2-SOS complex in insulin receptor signaling.
12091389 2002 Src-induced phosphorylation of caveolin-2 on tyrosine 19. Phospho-caveolin-2 (Tyr(P)19) is localized near focal adhesions, remains associated with lipid rafts/caveolae, but no longer forms a high molecular mass hetero-oligomer with caveolin-1.
11976319 2002 Identification of Aurora kinases as RasGAP Src homology 3 domain-binding proteins.
11896619 2002 SHP-2 is involved in heterodimer specific loss of phosphorylation of Tyr771 in the PDGF beta-receptor.
11786539 2002 The delta subunit of retinal rod cGMP phosphodiesterase regulates the membrane association of Ras and Rap GTPases.
11751853 2002 The heparin-binding domain and V region of fibronectin regulate apoptosis by suppression of p53 and c-myc in human primary cells.
11604231 2001 Sam68 is a docking protein linking GAP and PI3K in insulin receptor signaling.
11536198 2001 Tyrosine phosphorylation of p190 RhoGAP by Fyn regulates oligodendrocyte differentiation.
11389730 2001 Differential actions of p60c-Src and Lck kinases on the Ras regulators p120-GAP and GDP/GTP exchange factor CDC25Mm.
11350068 2001 RACK1, a protein kinase C scaffolding protein, interacts with the PH domain of p120GAP.
11331873 2001 Tyrosine-phosphorylated SOCS-3 inhibits STAT activation but binds to p120 RasGAP and activates Ras.
11116152 2001 A mouse homologue of the Drosophila tumor suppressor l(2)tid gene defines a novel Ras GTPase-activating protein (RasGAP)-binding protein.
11071635 2000 Stem cell factor induces phosphatidylinositol 3'-kinase-dependent Lyn/Tec/Dok-1 complex formation in hematopoietic cells.
10899172 2000 Specificity of the binding of synapsin I to Src homology 3 domains.
10799545 2000 Evidence that Llck-mediated phosphorylation of p56dok and p62dok may play a role in CD2 signaling.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
10713673 2000 RAFTK/Pyk2 tyrosine kinase mediates the association of p190 RhoGAP with RasGAP and is involved in breast cancer cell invasion.
10708762 2000 Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.
10697503 GM1 inhibits early signaling events mediated by PDGF receptor in cultured human glioma cells.
10669731 2000 Nck-interacting Ste20 kinase couples Eph receptors to c-Jun N-terminal kinase and integrin activation.
10644995 2000 Replacing two conserved tyrosines of the EphB2 receptor with glutamic acid prevents binding of SH2 domains without abrogating kinase activity and biological responses.
10571081 1999 Mapping the site of interaction between annexin VI and the p120GAP C2 domain.
10508618 1999 Recruitment of Dok-R to the EGF receptor through its PTB domain is required for attenuation of Erk MAP kinase activation.
10319320 1999 16K human prolactin inhibits vascular endothelial growth factor-induced activation of Ras in capillary endothelial cells.
10200531 1998 Proteolytic cleavage of ras GTPase-activating protein during apoptosis.
10187839 1999 Proline-rich motifs of the Na+/H+ exchanger 2 isoform. Binding of Src homology domain 3 and role in apical targeting in epithelia.
10092539 1999 Signaling transduction pathway of angiotensin II in human mesangial cells: mediation of focal adhesion and GTPase activating proteins.
9674711 1998 Tyrosine-614, the major autophosphorylation site of the receptor tyrosine kinase HEK2, functions as multi-docking site for SH2-domain mediated interactions.
9632780 1998 A novel phosphorylation-dependent RNase activity of GAP-SH3 binding protein: a potential link between signal transduction and RNA stability.
9603468 1998 Thymocyte activation induces the association of the proto-oncoprotein c-cbl and ras GTPase-activating protein with CD5.
9564850 1998 Guanosine triphosphatase-activating protein-associated protein, but not src-associated protein p68 in mitosis, is a part of insulin signaling complexes.
9233798 1997 Juxtamembrane tyrosine residues couple the Eph family receptor EphB2/Nuk to specific SH2 domain proteins in neuronal cells.
9219684 1997 The Ras-RasGAP complex: structural basis for GTPase activation and its loss in oncogenic Ras mutants.
9218456 1997 Syk is required for BCR-mediated activation of p90Rsk, but not p70S6k, via a mitogen-activated protein kinase-independent pathway in B cells.
9174053 1997 ALK, the chromosome 2 gene locus altered by the t(2;5) in non-Hodgkin's lymphoma, encodes a novel neural receptor tyrosine kinase that is highly related to leukocyte tyrosine kinase (LTK)
9169421 1997 Identification of novel human WW domain-containing proteins by cloning of ligand targets.
9113414 1997 Ras-GTPase activating protein (GAP): a putative effector for Ras.
9079622 1997 SH3 domain-dependent association of huntingtin with epidermal growth factor receptor signaling complexes.
9034330 1997 Tandem SH2 binding sites mediate the RasGAP-RhoGAP interaction: a conformational mechanism for SH3 domain regulation.
9008161 1997 Identification of the Abl- and rasGAP-associated 62 kDa protein as a docking protein, Dok.
8955277 1996 Crystal structure of the GTPase-activating domain of human p120GAP and implications for the interaction with Ras.
8798684 1996 The Ca2+-dependent lipid binding domain of P120GAP mediates protein-protein interactions with Ca2+-dependent membrane-binding proteins. Evidence for a direct interaction between annexin VI and P120GAP.
8766817 1996 Sam68 from an immortalised B-cell line associates with a subset of SH3 domains.
8663024 1996 p120 Ras GTPase-activating protein interacts with Ras-GTP through specific conserved residues.
8649363 1996 A Ras-GTPase-activating protein SH3-domain-binding protein.
8618896 1995 Phosphotyrosine-independent binding of a 62-kDa protein to the src homology 2 (SH2) domain of p56lck and its regulation by phosphorylation of Ser-59 in the lck unique N-terminal region.
8570203 1996 Association of CD45 with Lck and components of the Ras signalling pathway in pervanadate-treated mouse T-cell lines.
8537347 1995 p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.
8395016 1993 Mapping of sites on the Src family protein tyrosine kinases p55blk, p59fyn, and p56lyn which interact with the effector molecules phospholipase C-gamma 2, microtubule-associated protein kinase, GTPase-activating protein, and phosphatidylinositol 3-kinase.
8384556 1993 Tyrosine 785 is a major determinant of Trk--substrate interaction.
8382774 1993 In vivo binding properties of SH2 domains from GTPase-activating protein and phosphatidylinositol 3-kinase.
8360177 1993 Purification, characterization, and cellular localization of the 100-kDa human placental GTPase-activating protein.
8344248 1993 The N-terminal region of GAP regulates cytoskeletal structure and cell adhesion.
8275088 1993 Nonsense mutations in the C-terminal SH2 region of the GTPase activating protein (GAP) gene in human tumours.
8270251 1994 Genetic analysis of the catalytic domain of the GAP gene in human lung cancer cell lines.
8155326 1994 Trk receptors use redundant signal transduction pathways involving SHC and PLC-gamma 1 to mediate NGF responses.
8137811 1994 Solution structure of GAP SH3 domain by 1H NMR and spatial arrangement of essential Ras signaling-involved sequence.
8084603 1994 Human ltk receptor tyrosine kinase binds to PLC-gamma 1, PI3-K, GAP and Raf-1 in vivo.
8006063 1994 Species specificity and organ, cellular and subcellular localization of the 100 kDa Ras GTPase activating protein.
7782336 1995 The Ras GTPase-activating protein (GAP) is an SH3 domain-binding protein and substrate for the Src-related tyrosine kinase, Hck.
7760813 1995 Binding of ZAP-70 to phosphorylated T-cell receptor zeta and eta enhances its autophosphorylation and generates specific binding sites for SH2 domain-containing proteins.
7691175 1993 Phosphorylation of the ras GTPase-activating protein (GAP) by the p93c-fes protein-tyrosine kinase in vitro and formation of GAP-fes complexes via an SH2 domain-dependent mechanism.
7642582 1995 Localization of the insulin-like growth factor I receptor binding sites for the SH2 domain proteins p85, Syp, and GTPase activating protein.
7628625 1995 Ras binding to a C-terminal region of GAP.
7544435 1995 The nonreceptor protein-tyrosine kinase CSK complexes directly with the GTPase-activating protein-associated p62 protein in cells expressing v-Src or activated c-Src.
7537265 1995 Functional interaction between c-Src and its mitotic target, Sam 68.
7478585 1995 Regulation of the Ras signaling pathway by GTPase-activating protein in PC12 cells.
3201259 1988 Molecular cloning of two types of GAP complementary DNA from human placenta.
2833817 1988 Guanosine triphosphatase activating protein (GAP) interacts with the p21 ras effector binding domain.
2821624 1987 A cytoplasmic protein stimulates normal N-ras p21 GTPase, but does not affect oncogenic mutants.
2574500 1989 Chromosome localization and cDNA sequence of murine and human genes for ras p21 GTPase activating protein (GAP).
2307479 1990 Chromosomal localization of the gene encoding GTPase-activating protein (RASA) to human chromosome 5, bands q13-q15.
2188736 1990 ras p21 and GAP inhibit coupling of muscarinic receptors to atrial K+ channels.
2176151 1990 The tyrosine phosphorylated carboxyterminus of the EGF receptor is a binding site for GAP and PLC-gamma.
2172781 1990 Interactions of phosphatidylinositol kinase, GTPase-activating protein (GAP), and GAP-associated proteins with the colony-stimulating factor 1 receptor.
2164710 1990 Inhibition of GTPase activating protein stimulation of Ras-p21 GTPase by the Krev-1 gene product.
2157284 1990 Binding of GAP to activated PDGF receptors.
2123878 1990 Purification, characterization, and western blot analysis of human GTPase-activating protein from native and recombinant sources.
2122974 1990 Modulation of guanine nucleotides bound to Ras in NIH3T3 cells by oncogenes, growth factors, and the GTPase activating protein (GAP).
1850098 1991 The epidermal growth factor receptor phosphorylates GTPase-activating protein (GAP) at Tyr-460, adjacent to the GAP SH2 domains.
1756860 1991 Identification of amino acid residues of Ras protein that are essential for signal-transducing activity but not for enhancement of GTPase activity by GAP.
1717825 1991 Molecular features of the viral and cellular Src kinases involved in interactions with the GTPase-activating protein.
1689011 1990 Phosphorylation of GAP and GAP-associated proteins by transforming and mitogenic tyrosine kinases.
1633149 1992 Binding of the H-ras p21 GTPase activating protein by the activated epidermal growth factor receptor leads to inhibition of the p21 GTPase activity in vitro.
1581965 1992 Molecular cloning of cDNAs encoding the GAP-associated protein p190: implications for a signaling pathway from ras to the nucleus.
1553544 1992 GAP domains responsible for ras p21-dependent inhibition of muscarinic atrial K+ channel currents.
1544885 1992 p21rasGAP association with Fyn, Lyn, and Yes in thrombin-activated platelets.
1383690 1992 A limited set of SH2 domains binds BCR through a high-affinity phosphotyrosine-independent interaction.
1375321 1992 GTPase-activating protein and phosphatidylinositol 3-kinase bind to distinct regions of the platelet-derived growth factor receptor beta subunit.
1347942 1992 An interaction between p21ras and heat shock protein hsp60, a chaperonin.
1336372 1992 Agonist-induced association of the p21ras GTPase-activating protein with phosphatidylinositol 3-kinase.
1331107 1992 Interaction between the p21ras GTPase activating protein and the insulin receptor.
1314164 1992 Phosphorylation sites in the PDGF receptor with different specificities for binding GAP and PI3 kinase in vivo.