Property Summary

NCBI Gene PubMed Count 119
PubMed Score 278.60
PubTator Score 238.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 4.400 2.7e-09
adrenocortical carcinoma -1.855 1.9e-02
non-small cell lung cancer -1.156 4.7e-08
intraductal papillary-mucinous adenoma (... -3.800 9.4e-05
intraductal papillary-mucinous carcinoma... -4.300 2.4e-04
intraductal papillary-mucinous neoplasm ... -4.100 2.7e-03
X-linked cerebral adrenoleukodystrophy 2.700 1.0e-03
lung cancer -3.100 1.3e-06
colon cancer -1.100 2.1e-02
breast carcinoma -1.600 1.1e-03
fibroadenoma -2.400 2.1e-03
interstitial cystitis 1.600 2.2e-03
pilocytic astrocytoma 1.900 3.5e-07
non primary Sjogren syndrome sicca 1.400 1.8e-02
lung adenocarcinoma -2.400 6.7e-11
lung carcinoma -1.900 1.8e-18
ductal carcinoma in situ -2.000 5.4e-04
invasive ductal carcinoma -2.500 1.9e-03
ovarian cancer -3.200 1.5e-06
Gaucher disease type 3 -2.100 4.9e-02
pituitary cancer -2.100 5.0e-07
head and neck cancer -1.100 7.1e-03

 GO Function (1)

Gene RIF (106)

PMID Text
26722546 The synovial fluid and synovial membrane levels of chemerin are increased in knee osteoarthritis patients
26721419 Suggest reduction of chemerin could contribute to the antiobesity/antidiabetic properties described for alpha-lipoic acid.
26471865 serum chemerin may have a role in acute ischemic stroke and carotid artery plaque instability in Chinese populations
26387454 Patients with PCOS showed increased serum chemerin concentrations as compared to healthy women
26277777 Together, these findings suggest that CCL2, RARRES2 and EFNB2 are host cell factors involved in respiratory syncytial virus replication.
26170530 Results show that patients with osteoporosis presented a higher level of serum chemerin, which witnessed an inverse correlation with bone marrow density.
26166341 there was no significant association between chemerin rs17173608 gene polymorphism and polycystic ovary syndrome after adjusting genotypes for body mass index and age.
26146067 plasma levels of chemerin and CRP are elevated in patients with acute coronary syndrome
26062410 Chemerin might induce insulin resistance in C2C12 cells through NF-kappaB pathway-mediated inflammatory reaction
26057200 chemerin is a novel biomarker of dilated cardiomyopathy
25933030 circulating chemerin is likely linked to enhanced beta cell function but not to insulin sensitivity in patients with non alcoholic fatty liver disease.
25637017 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25521368 The role of genetic variation in the RARRES2 locus in the regulation of circulating chemerin concentrations. [Meta-analysis]
25469985 Studies suggest that chemerin played an important role in the pathophysiology of obesity and metabolic syndrome (MS).
25445606 our results suggest that high serum chemerin levels are associated with inflammation and pre-eclampsia independently, as well as chemerin may play a role as predictive biomarker for pre-eclampsia
25433840 The mean serum CHEM concentration in an anorexia nervosa group was significantly lower than in controls and obesity groups.
25373013 Chemerin levels were significantly increased not only in obese patients with polycystic ovary syndrome (PCOS), but also in nonobese PCOS women
25278490 In present review, we aim to consolidate recent data of investigations on chemerin in context to functional characteristics with a special reference to its role as a metabolic signal in inflammation and non-metabolic syndromes
25152503 results suggest that high plasma chemerin levels are associated with long-term poor prognosis and survival of gastric cancer as well as may play a role as prognostic biomarker in gastric cancer survival.
25121101 The study for the first time confirmed a marked expression of chemerin and CMKLR1 in the liver of chronic hepatitis patients.
25028378 Chemerin is associated with endothelial activation and atherosclerosis in rheumatoid arthritis.
24977972 An increase of chemerin levels in patients with multiple sclerosis is associated with overweight and obesity.
24950152 lower chemerin appears to be an important hormone involved in cardiometabolic risk and glucose-stimulated insulin secretion reduction following exercise in older adults
24880897 plasma chemerin is associated with systemic markers of inflammation and components of the metabolic syndrome.
24840719 Chemerin significantly decreased TNF-alpha-induced NF-kappaB and VCAM-1 in human umbilical vein endothelial cell
24779513 Results lend some support to a presumable role of locally produced chemerin in the progression of atherosclerotic lesions, possibly acting through its CMKLR1 receptor.
24769499 Chemerin, which plays a role in inflammation and atherosclerosis, was higher in non-dippers compared to dippers and normotensives.
24660117 Chemerin functions in host defense as a broad spectrum antimicrobial protein against bacteria and fungi and as a leukocyte attractant for macrophages.
24628007 Data suggest plasma chemerin is down-regulated in third trimester in women with gestational diabetes and remains low 3-4 months following delivery even though glucose tolerance is normalized; plasma chemerin is up-regulated in normal pregnant women.
24524360 Data suggest that adiposity is main determinant of up-regulation of chemerin/RARRES2 and down-regulation of omentin/ITLN1 levels in plasma of lean/overweight/obese women with polycystic ovary syndrome.
24334424 increased during normal gestation and is associated with maternal body mass index and insulin resistance
24274970 Serum chemerin is significantly higher in gastric cancer patients than healthy subjects.
24217118 Moderate walking on a regular basis is sufficient to reduce chemerin levels, therefore the practice of physical exercise for type 2 diabetes mellitus patients should be encouraged.
23935128 chemerin mRNA expression is significantly elevated in the liver of non-alcoholic steatohepatitis patients
23906870 conclusion current data show that primary human hepatocytes are a major source of hepatic chemerin and increased liver chemerin in non-alcoholic steatohepatitis
23904282 Chemerin does not display a day/night variation, while acute energy deprivation resulted in a significant drop in circulating chemerin levels.
23682797 serum chemerin decrease is associated with improved insulin sensitivity, and may be involved in the beneficial effects of lifestyle intervention in overweight and obese type 2 diabetic patients
23559624 These data support a new role for chemerin as an endogenous vasoconstrictor that operates through a receptor typically attributed to function only in immune cells.
23527010 Using a panel of overlapping chemerin-derived synthetic peptides, we demonstrate that the antibacterial activity of chemerin is primarily mediated by Val(66)-Pro(85), which causes direct bacterial lysis.
23507574 Chemerin, a novel target gene of FXR, is related to nonalcoholic steatohepatitis.
23495698 Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease might trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1.
23303213 We make the novel observation of abnormal circulating and gluteal fat-secreted chemerin and omentin-1 levels in nascent metabolic syndrome, which could confer a higher risk for diabetes and cardiovascular disease.
23235922 chemerin (p<0.01) and leptin (p<0.01) were significantly decreased after fasting. For leptin, this decrease was also significant after 36 h (p<0.01). Adiponectin levels remained unchanged.
23211604 Serum chemerin concentrations correlated with BMI, whereas chemerin mRNA levels in adipose tissue did not.
23195684 studies show that mitochondrial ROS are important for autophagy in chemerin-induced angiogenesis and that targeting autophagy may provide an important new tool for treating cardiovascular disease
22986456 These results suggest the role of chemerin in sex dimorphism and a potential link between chemerin levels and type two diabetes mellitus pathogenesis in a Japanese population.
22982016 Finding showed positive association between chemerin rs17173608 polymorphism and risk of Metabolic syndrome (MeS) (chi(2)=7.70, p=0.021) in Zahedan, southeast Iran.
22925375 Cord blood chemerin was present in cord blood and its concentrations were positively correlated with birthweight. These novel findings support a role of adipokines in fetal growth.
22828724 data suggest that increased chemerin levels are associated with the presence of coronary artery disease and that serum chemerin levels may reflect the extent of coronary atherosclerosis.
22815691 Serum fetuin A levels were higher in prevalent hepatic steatosis patients with hepatic steatosis, and positively correlated with chemerin levels
22791765 Our data indicate that chemerin is up-regulated during decidualization and might contribute to natural killer cell accumulation and vascular remodeling during early pregnancy.
22783586 Elevated serum chemerin levels are associated with the presence of coronary artery disease in patients with type 2 diabetes.
22768214 These results rule out the direct anti-inflammatory effect of chemerin on macrophages ex vivo, described previously in the literature, despite the expression of a functional ChemR23 receptor in these cells.
22634313 the present study has shown that chemerin plays an inhibitory role on inflammatory state of vascular endothelial cells.
22610747 review of current research on biological roles of chemerin and chemokine-like receptor 1; highlight roles in mediating obesity and development of type 2 diabetes [REVIEW]
22544171 fat depot-specific differential regulation of chemerin mRNA expression might contribute to the distinctive roles of subcutaneous vs. visceral adipose tissue in human obesity.
22524287 At the time of term Caesarean section, preexisting maternal obesity, and its associated insulin resistance, is associated with higher cord plasma chemerin concentrations.
22447628 Chemerin reduces insulin-like growth factor-1(IGF-1)-induced steroidogenesis and cell proliferation through a decrease in the activation of IGF-1 receptor signalling pathways in primary human granulosa cells
22447224 Chronic ethanol consumption dose-dependently increases the chemerin levels in the serum and visceral adipose tissue.
22438234 Data suggest association of serum chemerin level with obesity and vascular inflammation; data support role for chemerin as molecular link between increasing fat mass, insulin resistance, and early atherogenic risk profile in obese children.
22369992 detected in cytoplasm of third trimester placental cytotrophoblast and Hofbauer's cells
22296200 the rise of plasma levels of chemerin and VEGF, and their positive correlation with ankle/brachial index in diabetic peripheral vascular disease
22239017 Chemerin expression was lower in hepatocellular carcinoma & correlated with tumor size, grade, DC & NK infiltration, & survival.
22136911 Reduced chemerin expression and serum concentration may contribute to improved insulin sensitivity and subclinical inflammation beyond significant weight
22117111 Chemerin levels are significantly increased in preeclampsia and independently associated with markers of dyslipidemia and with the severity of the preeclampsia
22104178 High circulating chemerin level is correlated with arterial stiffness.
22042485 Data suggest that serum chemerin levels are increased with increases in the number of diseased vessels in subjects with coronary artery disease in China.
22037282 Human synovial fibroblasts express both chemerin and its receptor. Chemerin enhanced expression of TLR4 and induced release of CCL2 in synovial fibroblasts.
21981776 Expressions of chemerin mRNA and protein are significantly higher in epicardial adipose tissue of Han Chinese patients who have atherosclerosis.
21959042 Chemerin and ChemR23 were highly expressed in the rheumatoid arthritis synovium compared with osteoarthritis.
21949124 the necessity of appropriate C-terminal proteolytic processing to generate the likely physiologic form of active chemerin, chem157S, and suggested a possible role in malignant GBM.
21930706 chemerin undergoes extensive proteolytic processing in vivo, underlining the importance of measuring individual isoforms.
21895733 Chemerin may be a mediator that links visceral obesity to cardiovascular risk factors.
21738955 Data indicating a possible role of leptin, adiponectin, visfatin, chemerin and vaspin in the pathogenesis of chronic hepatitis are summarized.
21576834 Serum chemerin levels were significantly elevated in metabolic syndrome patients with coronary artery disease (CAD) compared to in those without CAD and healthy subjects.
21477622 maternal chemerin serum concentrations are significantly increased in preeclampsia during and after pregnancy
21346723 The ChemR23/Chemerin axis may have a role in the recruitment of dendritic cells within the kidney in patients affected by lupus nephritis.
21192818 These results demonstrate that human chondrocytes express both the receptor ChemR23 and the ligand chemerin...which may play pivotal roles in joint inflammation.
21144611 Serum chemerin levels are strongly associated with renal function in diabetic patients.
21085476 Data show that comparing to T2D the IFG subjects had higher serum chemerin, progranulin, fetuin-A and RBP4 levels which was not detectable in the comparison of the T2D and IGT group.
20822885 Elevated systemic levels of chemerin and leptin in psoriasis seem to be associated not only with metabolic syndrome risk factors but also with psoriasis.
20817486 The dual role of chemerin in inflammation and metabolism might provide a link between chronic inflammation and obesity, as well as obesity-related disorders such as type 2 diabetes and cardiovascular disease.
20601896 potential link of chemerin with the pathogenesis of insulin resistance, obesity, and metabolic syndrome
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20375212 This study suggests that chemerin might mediate metabolic alterations in obesity, drastically improving after gastric bypass.
20237162 Plasma chemerin levels are significantly heritable and are identify a novel role for chemerin as a stimulator of angiogenesis.
20095887 Serum chemerin concentration was significantly higher in non-alcoholic fatty liver disease patients.
19898481 Observational study of gene-disease association. (HuGE Navigator)
19837789 Data demonstrate that markers of renal function are independently related to circulating chemerin levels.
19720798 Adipocyte-derived secretion of chemerin may be involved in the negative cross talk between adipose tissue and skeletal muscle contributing to the negative relationship between obesity and insulin sensitivity.
19714754 Circulating levels of chemerin are higher in ulcerative colitis and Crohn's disease.
19558533 Elevated systemic levels of chemerin in obesity and type 2 diabetes seem to be associated with inflammation rather than body mass index.
19543554 differences in the distribution of NK cells and pDC in skin lesions suggest that recruitment of both NK cells and pDC is unlikely to be controlled solely by chemerin
19470637 Circulating chemerin levels were associated with metabolic syndrome phenotypes in a second, unrelated human population.
19443732 Epithelial cells in fetal intestine produce chemerin to recruit macrophages.
19303973 Magnetic resonance imaging-quantified visceral fat mass was associated with RARRES2 SNP rs17173608 and nominally associated with RARRES2 SNP rs10278590 in nonobese subjects, with carriers of the minor alleles displaying lower visceral adipose tissue mass
19303973 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19114666 Chemerin expression specifically marks the early phases of evolving skin psoriatic lesions and is temporally strictly associated with plasmacytoid dendritic cells.
19010784 circulating carboxypeptidase N/ carboxypeptidase B and platelets may potentially contribute to regulating the bioactivity of leukocyte chemoattractant chemerin
18955196 TIG2-protein and transcript were detected in all layers of normal epidermis and uninvolved skin adjacent to SCC lesions.
18794339 Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2.
18242188 These data establish that chemerin is a novel adipokine that regulates adipocyte function.
17635925 chemerin is a novel adipose-derived signaling molecule that regulates adipogenesis and adipocyte metabolism
16096270 chemerin is activated by serine proteases of the coagulation, fibrinolytic, and inflammatory cascades
15972683 degranulated PMNs release proteases that efficiently convert prochemerin into active chemerin
15728234 Chemerin is a chemotactic agent and ligand of CMKLR1 (ChemR23). The CMKLR1/chemerin axis may play a key role in directing plasmacytoid monocyte-derived dendritic cell trafficking.

AA Sequence

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF      1 - 70
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR     71 - 140
AGEDPHSFYFPGQFAFSKALPRS                                                   141 - 163
//

Text Mined References (122)

PMID Year Title
26722546 2015 Elevated chemerin levels in synovial fluid and synovial membrane from patients with knee osteoarthritis.
26721419 2016 Effects of alpha-lipoic acid on chemerin secretion in 3T3-L1 and human adipocytes.
26471865 2015 Association of Serum Chemerin Levels with Acute Ischemic Stroke and Carotid Artery Atherosclerosis in a Chinese Population.
26387454 2015 Increased serum chemerin concentrations in patients with polycystic ovary syndrome: Relationship between insulin resistance and ovarian volume.
26277777 2015 Identification of CCL2, RARRES2 and EFNB2 as host cell factors that influence the multistep replication of respiratory syncytial virus.
26170530 2015 Serum Chemerin Levels in relation to Osteoporosis and Bone Mineral Density: A Case-Control Study.
26166341 2015 Influence of chemerin rs17173608 polymorphism on polycystic ovary syndrome susceptibility.
26146067 2015 [The elevated levels of plasma chemerin and C-reactive protein in patients with acute coronary syndrome].
26062410 2015 [Chemerin induces insulin resistance in C2C12 cells through nuclear factor-?B pathway-mediated inflammatory reaction].
26057200 2015 Circulating chemerin levels elevated in dilated cardiomyopathy patients with overt heart failure.
25933030 2015 Serum Chemerin Concentrations Associate with Beta-Cell Function, but Not with Insulin Resistance in Individuals with Non-Alcoholic Fatty Liver Disease (NAFLD).
25637017 2015 ChemR23, the receptor for chemerin and resolvin E1, is expressed and functional on M1 but not on M2 macrophages.
25521368 2014 Genome wide meta-analysis highlights the role of genetic variation in RARRES2 in the regulation of circulating serum chemerin.
25469985 2014 Association between serum chemerin concentrations and clinical indices in obesity or metabolic syndrome: a meta-analysis.
25445606 2014 The predictive value of the first-trimester maternal serum chemerin level for pre-eclampsia.
25433840 2014 Chemerin serum levels in girls with anorexia nervosa.
25373013 2014 Higher levels of circulating chemerin in both lean and obese patients with polycystic ovary syndrome.
25278490 2014 New roles of the multidimensional adipokine: chemerin.
25152503 2014 Prognostic significance of plasma chemerin levels in patients with gastric cancer.
25121101 2014 Hepatic chemerin and chemokine-like receptor 1 expression in patients with chronic hepatitis C.
25028378 2014 Circulating concentrations of the novel adipokine chemerin are associated with cardiovascular disease risk in rheumatoid arthritis.
24977972 2014 Plasma chemerin levels in patients with multiple sclerosis.
24964207 2014 Genetic relationships between suicide attempts, suicidal ideation and major psychiatric disorders: a genome-wide association and polygenic scoring study.
24950152 2014 Exercise-induced lowering of chemerin is associated with reduced cardiometabolic risk and glucose-stimulated insulin secretion in older adults.
24880897 2014 Low dose aspirin is associated with plasma chemerin levels and may reduce adipose tissue inflammation.
24840719 2015 Chemerin plays a protective role by regulating human umbilical vein endothelial cell-induced nitric oxide signaling in preeclampsia.
24779513 2014 Chemerin and CMKLR1 expression in human arteries and periadventitial fat: a possible role for local chemerin in atherosclerosis?
24769499 2014 Evaluation of plasma chemerin levels in patients with non-dipper blood pressure patterns.
24660117 2014 Chemerin regulation and role in host defense.
24628007 2014 Decreased plasma chemerin levels in women with gestational diabetes mellitus.
24524360 2014 Omentin and chemerin and their association with obesity in women with polycystic ovary syndrome.
24334424 2014 Chemerin concentrations in maternal and fetal compartments: implications for metabolic adaptations to normal human pregnancy.
24274970 2014 Increased serum chemerin level promotes cellular invasiveness in gastric cancer: a clinical and experimental study.
24217118 2014 The positive effect of moderate walking exercise on chemerin levels in Portuguese patients with type 2 diabetes mellitus.
23935128 2013 Elevated hepatic chemerin mRNA expression in human non-alcoholic fatty liver disease.
23906870 2013 Chemerin is highly expressed in hepatocytes and is induced in non-alcoholic steatohepatitis liver.
23904282 2013 Chemerin is expressed mainly in pancreas and liver, is regulated by energy deprivation, and lacks day/night variation in humans.
23682797 2014 Effect of lifestyle modification on serum chemerin concentration and its association with insulin sensitivity in overweight and obese adults with type 2 diabetes.
23559624 2013 Chemerin connects fat to arterial contraction.
23527010 2013 Chemerin is an antimicrobial agent in human epidermis.
23507574 2013 Identification of chemerin as a novel FXR target gene down-regulated in the progression of nonalcoholic steatohepatitis.
23495698 2013 Proteolytic activation of prochemerin by kallikrein 7 breaks an ionic linkage and results in C-terminal rearrangement.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23303213 2013 Increased chemerin and decreased omentin-1 in both adipose tissue and plasma in nascent metabolic syndrome.
23235922 2013 Prolonged fasting and the effects on biomarkers of inflammation and on adipokines in healthy lean men.
23216632 2013 Towards an integrative approach to understanding the role of chemerin in human health and disease.
23211604 2013 The increase of serum chemerin concentration is mainly associated with the increase of body mass index in obese, non-diabetic subjects.
23195684 2013 Oxidative stress mediates chemerin-induced autophagy in endothelial cells.
22986456 2013 Decreased serum chemerin levels in male Japanese patients with type 2 diabetes: sex dimorphism.
22982016 2012 Association between chemerin rs17173608 and vaspin rs2236242 gene polymorphisms and the metabolic syndrome, a preliminary report.
22925375 2012 Chemerin is present in human cord blood and is positively correlated with birthweight.
22828724 2012 Serum chemerin levels are associated with the presence and extent of coronary artery disease.
22815691 2012 Serum fetuin A and chemerin levels correlate with hepatic steatosis and regional adiposity in maintenance hemodialysis patients.
22791765 2012 Chemerin regulates NK cell accumulation and endothelial cell morphogenesis in the decidua during early pregnancy.
22783586 2012 Elevated serum chemerin levels are associated with the presence of coronary artery disease in patients with type 2 diabetes.
22768214 2012 The chemerin/ChemR23 system does not affect the pro-inflammatory response of mouse and human macrophages ex vivo.
22634313 2012 A novel adipocytokine, chemerin exerts anti-inflammatory roles in human vascular endothelial cells.
22610747 2012 Chemerin: a potential endocrine link between obesity and type 2 diabetes.
22544171 2012 Differential patterns of serum concentration and adipose tissue expression of chemerin in obesity: adipose depot specificity and gender dimorphism.
22524287 2012 Increased chemerin concentrations in fetuses of obese mothers and correlation with maternal insulin sensitivity.
22447628 2012 Chemerin inhibits IGF-1-induced progesterone and estradiol secretion in human granulosa cells.
22447224 2012 Chronic ethanol consumption increases the levels of chemerin in the serum and adipose tissue of humans and rats.
22438234 2012 Chemerin as a mediator between obesity and vascular inflammation in children.
22369992 2012 Expression and regulation of chemerin during rat pregnancy.
22296200 2012 Correlation of peripheral arterial blood flow with plasma chemerin and VEGF in diabetic peripheral vascular disease.
22239017 2011 Reduced expression of chemerin is associated with a poor prognosis and a lowed infiltration of both dendritic cells and natural killer cells in human hepatocellular carcinoma.
22136911 2012 Effects of weight loss and exercise on chemerin serum concentrations and adipose tissue expression in human obesity.
22119008 Chemerin and its receptors in leukocyte trafficking, inflammation and metabolism.
22117111 2011 Serum levels of the adipokine chemerin in preeclampsia.
22104178 2012 Circulating chemerin level is independently correlated with arterial stiffness.
22042485 2012 The association of serum chemerin level with risk of coronary artery disease in Chinese adults.
22037282 2012 Chemerin induces CCL2 and TLR4 in synovial fibroblasts of patients with rheumatoid arthritis and osteoarthritis.
21981776 2011 Association of chemerin mRNA expression in human epicardial adipose tissue with coronary atherosclerosis.
21959042 2011 Chemerin activates fibroblast-like synoviocytes in patients with rheumatoid arthritis.
21949124 2011 Proteolytic cleavage of chemerin protein is necessary for activation to the active form, Chem157S, which functions as a signaling molecule in glioblastoma.
21930706 2011 Chemerin158K protein is the dominant chemerin isoform in synovial and cerebrospinal fluids but not in plasma.
21895733 2012 Chemerin levels are positively correlated with abdominal visceral fat accumulation.
21738955 2011 Potential role of leptin, adiponectin and three novel adipokines--visfatin, chemerin and vaspin--in chronic hepatitis.
21715684 2011 Regulation of chemerin chemoattractant and antibacterial activity by human cysteine cathepsins.
21576834 2011 Elevated serum chemerin levels are associated with the presence of coronary artery disease in patients with metabolic syndrome.
21477622 2011 Serum levels of the adipokine chemerin are increased in preeclampsia during and 6 months after pregnancy.
21346723 2011 The possible role of ChemR23/Chemerin axis in the recruitment of dendritic cells in lupus nephritis.
21192818 2010 Human articular chondrocytes express ChemR23 and chemerin; ChemR23 promotes inflammatory signalling upon binding the ligand chemerin(21-157).
21144611 2011 Elevated serum chemerin concentrations are associated with renal dysfunction in type 2 diabetic patients.
21085476 2010 Adipokine pattern in subjects with impaired fasting glucose and impaired glucose tolerance in comparison to normal glucose tolerance and diabetes.
20822885 2010 Circulating level of chemerin is upregulated in psoriasis.
20817486 2010 Chemerin: at the crossroads of inflammation and obesity.
20601896 2010 Elevated plasma levels of chemerin in newly diagnosed type 2 diabetes mellitus with hypertension.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
20375212 2010 Chemerin correlates with markers for fatty liver in morbidly obese patients and strongly decreases after weight loss induced by bariatric surgery.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
20095887 2010 Serum chemerin and vaspin in non-alcoholic fatty liver disease.
20011981 2009 Proteolytic regulatory mechanism of chemerin bioactivity.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19837789 2010 Serum levels of the adipokine chemerin in relation to renal function.
19720798 2009 Chemerin is a novel adipocyte-derived factor inducing insulin resistance in primary human skeletal muscle cells.
19714754 2010 Circulating levels of chemerin and adiponectin are higher in ulcerative colitis and chemerin is elevated in Crohn's disease.
19558533 2010 Systemic chemerin is related to inflammation rather than obesity in type 2 diabetes.
19543554 2009 Chemerin and the recruitment of NK cells to diseased skin.
19470637 2009 Chemerin is associated with metabolic syndrome phenotypes in a Mexican-American population.
19443732 2009 Epithelial cells in fetal intestine produce chemerin to recruit macrophages.
19303973 2009 RARRES2, encoding the novel adipokine chemerin, is a genetic determinant of disproportionate regional body fat distribution: a comparative magnetic resonance imaging study.
19114666 2009 Chemerin expression marks early psoriatic skin lesions and correlates with plasmacytoid dendritic cell recruitment.
19010784 2009 Regulation of chemerin bioactivity by plasma carboxypeptidase N, carboxypeptidase B (activated thrombin-activable fibrinolysis inhibitor), and platelets.
18955196 Downregulation of tazarotene induced gene-2 (TIG2) in skin squamous cell carcinoma.
18794339 2008 Mast cell-expressed orphan receptor CCRL2 binds chemerin and is required for optimal induction of IgE-mediated passive cutaneous anaphylaxis.
18242188 2008 Chemerin enhances insulin signaling and potentiates insulin-stimulated glucose uptake in 3T3-L1 adipocytes.
17767914 2007 Chemerin--a new adipokine that modulates adipogenesis via its own receptor.
17635925 2007 Chemerin, a novel adipokine that regulates adipogenesis and adipocyte metabolism.
16096270 2005 Chemerin activation by serine proteases of the coagulation, fibrinolytic, and inflammatory cascades.
15972683 2005 Neutrophil-mediated maturation of chemerin: a link between innate and adaptive immunity.
15728234 2005 Role of ChemR23 in directing the migration of myeloid and plasmacytoid dendritic cells to lymphoid organs and inflamed skin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675762 2003 Characterization of human circulating TIG2 as a ligand for the orphan receptor ChemR23.
14530373 2003 Specific recruitment of antigen-presenting cells by chemerin, a novel processed ligand from human inflammatory fluids.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072769 1999 Selection of cDNAs encoding putative type II membrane proteins on the cell surface from a human full-length cDNA bank.
9270552 1997 Molecular mechanisms of tazarotene action in psoriasis.
9204961 1997 Tazarotene-induced gene 2 (TIG2), a novel retinoid-responsive gene in skin.