Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.02
PubTator Score 83.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma -6.300 1.2e-09
esophageal adenocarcinoma 2.000 2.0e-02
psoriasis -1.400 1.9e-02
cutaneous lupus erythematosus 2.100 3.1e-02
osteosarcoma 1.111 3.6e-02
posterior fossa group A ependymoma 2.300 4.8e-05
glioblastoma 1.900 7.5e-07
sonic hedgehog group medulloblastoma 1.600 8.2e-04
cystic fibrosis 1.998 1.5e-05
type II diabetes mellitus and post-ische... -1.100 3.7e-02
Atopic dermatitis -1.900 1.2e-03
adrenocortical carcinoma -1.765 6.1e-03
primary pancreatic ductal adenocarcinoma 2.059 3.7e-05
intraductal papillary-mucinous adenoma (... -3.000 5.6e-03
lung cancer -2.200 3.0e-04
colon cancer -2.400 5.4e-03
active Crohn's disease 1.898 5.4e-03
interstitial cystitis 1.800 4.3e-02
adult high grade glioma 2.100 1.1e-05
atypical teratoid/rhabdoid tumor 1.100 2.2e-04
pilocytic astrocytoma 3.500 3.8e-08
primary Sjogren syndrome 1.500 8.6e-03
lung carcinoma -1.100 5.5e-11
Breast cancer -3.800 9.4e-08
gastric carcinoma 3.800 9.4e-03
pterygium -1.500 3.9e-02
ductal carcinoma in situ 2.800 5.8e-03
invasive ductal carcinoma 2.400 4.7e-02
ovarian cancer -5.800 8.8e-08
pituitary cancer -4.100 5.5e-06
pancreatic cancer 1.800 9.0e-04

Gene RIF (17)

PMID Text
24014597 High TIG1 expression is associated with inflammatory breast cancer through activation of Axl kinase.
24006221 our data suggested that epigenetic silencing of TIG1 gene expression by promoter hypermethylation may play an important role in hepatocellular carcinoma .
22942771 All-trans retinoic acid modulated secretion of RARRES1 in a dose dependent manner.
22669512 Analysis of a standard liver fibrosis model (CCl(4)) demonstrated an early induction of RARRES1 mRNA and protein expression.
22615834 Knocking-down CTCF expression hampered RARRES1 expression.
22573467 genotype-associated hypermethylation of the ETS-family target gene RARRES1 influences methylation at its neighbor gene LXN and could be useful as a prognostic biomarker.
22126303 TIG1 suppressed PGE2-stimulated Wnt and cAMP signaling pathways in colon cancer cells through GRK5.
21575264 GRK5 mediates cell growth suppression by TIG1A. Thus, TIG1 may participate in the downregulation of G-protein coupled signaling by upregulating GRK5 expression.
21303978 RARRES1, its interacting partners AGBL2, Eg5/KIF11, another EEY-bearing protein (EB1), and the microtubule tyrosination cycle are important in tumorigenesis.
21168224 The results of this study suggested that short RAI1 alleles might be releated to schizophreina disease.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19806788 TIG1 undergoes frequent epigenetic inactivation due to aberrant DNA hypermethylation in gastric cancers.
19737656 Findings suggest that TIG1 may play a role in cellular proliferation and invasion in NPC cells and that its function may be dependent on the EBV status.
19250291 TIG1 overexpression in SASC inhibited their differentiation into osteocytes and the expression of osteocalcin
16134180 Hypermethylation of tazarotene-induced gene 1 is associated with gastric carcinogenesis
16128742 results show that inactivation of the retinoic acid signaling-associated genes RAR-beta, CRBP1, and TIG1 by DNA methylation occurs frequently in esophageal squamous cell carcinoma
15059893 Silencing of TIG1 promoter by hypermethylation is common in human cancers and may contribute to the loss of retinoic acid responsiveness in some neoplastic cells.

AA Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFF      1 - 70
NFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPT     71 - 140
INVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQV    141 - 210
SHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGT    211 - 280
EEGSAVVPTELSNF                                                            281 - 294
//

Text Mined References (27)

PMID Year Title
24014597 2013 TIG1 promotes the development and progression of inflammatory breast cancer through activation of Axl kinase.
24006221 2014 Aberrant TIG1 methylation associated with its decreased expression and clinicopathological significance in hepatocellular carcinoma.
22942771 2012 Secretome survey of human plexiform neurofibroma derived Schwann Cells reveals a secreted form of the RARRES1 protein.
22669512 2012 Identification of RARRES1 as a core regulator in liver fibrosis.
22615834 2012 Epigenetic repression of RARRES1 is mediated by methylation of a proximal promoter and a loss of CTCF binding.
22573467 2012 The SNP rs6441224 influences transcriptional activity and prognostically relevant hypermethylation of RARRES1 in prostate cancer.
22126303 2011 Tazarotene-induced gene 1 inhibits prostaglandin E2-stimulated HCT116 colon cancer cell growth.
21575264 2011 G protein-coupled receptor kinase 5 mediates Tazarotene-induced gene 1-induced growth suppression of human colon cancer cells.
21303978 2011 Tumor suppressor RARRES1 interacts with cytoplasmic carboxypeptidase AGBL2 to regulate the ?-tubulin tyrosination cycle.
21168224 2011 Retinoic acid induced 1 gene and clinical subtypes of schizophrenia: an association study.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19806788 2009 Expression and mutation analysis of TIG1 (tazarotene-induced gene 1) in human gastric cancer.
19737656 2009 Role of the RARRES1 gene in nasopharyngeal carcinoma.
19250291 2009 Involvement of tazarotene-induced gene 1 in proliferation and differentiation of human adipose tissue-derived mesenchymal stem cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16134180 2005 DNA methylation of genes linked with retinoid signaling in gastric carcinoma: expression of the retinoid acid receptor beta, cellular retinol-binding protein 1, and tazarotene-induced gene 1 genes is associated with DNA methylation.
16128742 2005 DNA methylation of genes linked to retinoid signaling in squamous cell carcinoma of the esophagus: DNA methylation of CRBP1 and TIG1 is associated with tumor stage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15059893 2004 Hypermethylation and silencing of the putative tumor suppressor Tazarotene-induced gene 1 in human cancers.
14691453 2004 Methylation of the retinoid response gene TIG1 in prostate cancer correlates with methylation of the retinoic acid receptor beta gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11929948 2002 Tazarotene-induced gene 1 (TIG1) expression in prostate carcinomas and its relationship to tumorigenicity.
9270552 1997 Molecular mechanisms of tazarotene action in psoriasis.
8832110 1996 Identification by differential display of a mRNA specifically induced by 12-O-tetradecanoylphorbol-13-acetate (TPA) in T84 human colon carcinoma cells.
8601727 1996 Tazarotene-induced gene 1 (TIG1), a novel retinoic acid receptor-responsive gene in skin.