Property Summary

NCBI Gene PubMed Count 69
PubMed Score 117.21
PubTator Score 165.98

Knowledge Summary

Patent (8,249)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.800 3.2e-07
esophageal adenocarcinoma -1.200 2.1e-02
cutaneous lupus erythematosus -1.200 7.8e-03
osteosarcoma 1.846 5.8e-06
atypical teratoid / rhabdoid tumor 1.300 5.2e-04
glioblastoma 1.300 8.3e-04
medulloblastoma, large-cell 1.200 4.1e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (40)

PMID Text
26237429 A nonsynonymous variant in RARG is highly associated with anthracycline-induced cardiotoxicity in childhood cancers.
25510432 deregulation of the retinoid/rexinoid signaling pathway has a major role and may represent a potential therapeutic target for NUP98-RARG-mediated transformation
24050824 The current status of knowledge indicates that there might be inter- or overlapping actions between PPARg and RARs, and there might be an association of PPARg/RARs(RARa, RARb, and RARg) with renal diseases
23798555 RARG plays an important role in the proliferation, metastasis, and chemoresistance of cholangiocarcinoma through simultaneous activation of the Akt/NF-kappaB and Wnt/beta-catenin pathways.
23518499 RARgamma in concert with ATRA regulates protein levels of CDK1 and its subcellular localization.
22901127 Low RARgamma expression is associated with advanced gastric cancer.
22362749 Evidence that the retinoic acid receptor gamma plays a major role in the regulation of the human prostatic transglutaminase gene.
21990348 findings demonstrate that signaling through RARs has critical roles in molecular reprogramming and that the synergistic interaction between Rarg and Lrh1 directs reprogramming toward ground-state pluripotency
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
21401418 results suggest that a RARgamma-dependent functional crosstalk is present between the retinoic acid and BMP2 signaling to induce osteogenic transdifferentiation in myoblastic C2C12 cells
21254357 One variant in the RARA gene (rs12051734), three variants in the RARB gene (rs6799734, rs12630816, rs17016462), and one variant in the RARG gene (rs3741434) were found to be statistically significant at p < 0.05 as risk factors for meningomyelocele.
21178008 Microbiota are required for the generation of both IL-17-positive and Foxp3-positive, retinoic acid-related orphan receptor gamma-positive transgenic T cell subsets in the intestinal lamina propria.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20420906 Retinoic acid receptor gamma 2 could specifically interact with vitamin D response elements, either in the presence or absence of the vitamin D receptor.
20387030 PARgamma expressions are decreased in PBMC and SWAT of obese subjects in weight gain.
20346360 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19732752 TNIP1 interacts with liganded RARalpha and RARgamma but acts as a corepressor of their activity.
19563758 Study found that RARalpha/RARgamma exhibit extensive colocalization of their genomic binding regions with ERalpha in the vicinity of genes that are antagonistically regulated by estrogen and RA.
19416983 the subcellular localization of RARgamma is regulated by complex interactions among ligand binding, receptor phosphorylation, and receptor dimerizations
19416972 The first 2250 bp of the HAS2 promoter contain three response elements (REs) for the transcription factor CREB1 as well as two REs for the nuclear receptor RAR
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18685608 analysis to determine directly whether PML-RAR, like PML-RAR, is able to induce APL
17325034 study elucidated a nongenomic extranuclear signal mediated by the RAR-SRC interaction that is negatively regulated by CSK and is required for RA-induced neuronal differentiation
17252005 Biological properties of the other RAR isoforms (RARbeta and RARgamma), through the generation pf fusion protein isoforms in acutte promyelocytic leukemia.
15734736 phosphorylation of the AF-1 domain controls RARgamma-mediated transcription through triggering the dissociation of vinexin beta
15635645 Observational study of gene-disease association. (HuGE Navigator)
15383624 Tazarotene is a prodrug selective for RARbeta/gamma, thereby motivating interest in determining whether tazarotene might activate putative tumor suppressor activity.
14705796 depletion of vitamin A and retinoid receptors by UV irradiation, together with unchanged or even increased c-Jun levels, might seriously interfere with retinoid signaling and thus promote future tumor development, especially in keratinocytes.
14691372 In a 9-cis retinoic acid-dependent fashion in cells in vitro, retinoic acid receptor isoform gamma stimulates the expression of reporter constructs containing the site that binds aldehyde dehydrogenase-2.
12665583 RAR beta and RAR gamma receptors appear to adopt a constitutively closed helix 12 conformation in the absence of hormone that may approximate the conformation of RAR alpha when bound to hormone agonist.
12554770 RARgamma interact only weakly with SMRT.
12399530 Present throughout the epithelium with minimal nuclear accumulation. Increased in basal and luminal epithelial nuclei in glands with benign prostatic hyperplasia.
12220491 The 1.4 A resolution crystal structure of the ligand binding domain of the retinoic acid receptor RARgamma complexed with the retinoid SR11254 reveals several types of C-H...O hydrogen bonds
12189556 Retinoids cause apoptosis in pancreatic cancer cells via activation of RAR-gamma and altered expression of Bcl-2/Bax.
11855864 Retinoid signaling is attenuated by retinoic acid-induced proteasome-mediated degradation of RARG in human keratocytes.

AA Sequence

MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS      1 - 70
EEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRN     71 - 140
RCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKY    141 - 210
TTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT    211 - 280
PEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKV    281 - 350
DKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE    351 - 420
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA                                        421 - 454
//

Text Mined References (72)

PMID Year Title
26237429 2015 A coding variant in RARG confers susceptibility to anthracycline-induced cardiotoxicity in childhood cancer.
25510432 2015 Critical role of retinoid/rexinoid signaling in mediating transformation and therapeutic response of NUP98-RARG leukemia.
24050824 2013 Association of peroxisome proliferator-activated receptors/retinoic acid receptors with renal diseases.
23798555 2013 Oncogenic activity of retinoic acid receptor ? is exhibited through activation of the Akt/NF-?B and Wnt/?-catenin pathways in cholangiocarcinoma.
23518499 2013 CDK1 interacts with RAR? and plays an important role in treatment response of acute myeloid leukemia.
22901127 2012 Retinoid receptors in gastric cancer: expression and influence on prognosis.
22362749 2012 Retinoic acid and androgen receptors combine to achieve tissue specific control of human prostatic transglutaminase expression: a novel regulatory network with broader significance.
21990348 2011 Rapid and efficient reprogramming of somatic cells to induced pluripotent stem cells by retinoic acid receptor gamma and liver receptor homolog 1.
21401418 2011 Retinoic acid receptor ?-dependent signaling cooperates with BMP2 to induce osteoblastic differentiation of C2C12 cells.
21254357 2011 Association of retinoic acid receptor genes with meningomyelocele.
21178008 2011 Restricted microbiota and absence of cognate TCR antigen leads to an unbalanced generation of Th17 cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20420906 2010 Retinoic acid receptor gamma 2 interactions with vitamin D response elements.
20413580 2010 Human ADA3 regulates RARalpha transcriptional activity through direct contact between LxxLL motifs and the receptor coactivator pocket.
20387030 2010 RARgamma and TRbeta expressions are decreased in PBMC and SWAT of obese subjects in weight gain.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19732752 2009 Liganded RARalpha and RARgamma interact with but are repressed by TNIP1.
19563758 2009 Genomic antagonism between retinoic acid and estrogen signaling in breast cancer.
19416983 2009 A unique cytoplasmic localization of retinoic acid receptor-gamma and its regulations.
19416972 2009 Regulation of the hyaluronan synthase 2 gene by convergence in cyclic AMP response element-binding protein and retinoid acid receptor signaling.
19345331 2009 ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18845237 2009 Retinoic acid regulates the human methionine sulfoxide reductase A (MSRA) gene via two distinct promoters.
18685608 2009 Redundant function of retinoic acid receptor isoforms in leukemogenesis unravels a prominent function of genome topology and architecture in the selection of mutagenic events in cancer.
18484682 2008 Wilms tumour histology is determined by distinct types of precursor lesions and not epigenetic changes.
18438858 2008 Functional characterization of hypertrophy in chondrogenesis of human mesenchymal stem cells.
17943189 2008 Retinoic acid increases aquaporin 3 expression in normal human skin.
17574023 2007 A microenvironment-induced myeloproliferative syndrome caused by retinoic acid receptor gamma deficiency.
17325034 2007 CSK controls retinoic acid receptor (RAR) signaling: a RAR-c-SRC signaling axis is required for neuritogenic differentiation.
17252005 2007 A redundant oncogenic potential of the retinoic receptor (RAR) alpha, beta and gamma isoforms in acute promyelocytic leukemia.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16456540 2006 P38MAPK-dependent phosphorylation and degradation of SRC-3/AIB1 and RARalpha-mediated transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15734736 2005 Vinexin beta interacts with the non-phosphorylated AF-1 domain of retinoid receptor gamma (RARgamma) and represses RARgamma-mediated transcription.
15635645 2005 Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383624 2004 A retinoic acid receptor beta/gamma-selective prodrug (tazarotene) plus a retinoid X receptor ligand induces extracellular signal-regulated kinase activation, retinoblastoma hypophosphorylation, G0 arrest, and cell differentiation.
14705796 2003 Differential effects of UV irradiation on nuclear retinoid receptor levels in cultured keratinocytes and melanocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691372 2003 Identification of a retinoid receptor response element in the human aldehyde dehydrogenase-2 promoter.
12665583 2003 Isotype-restricted corepressor recruitment: a constitutively closed helix 12 conformation in retinoic acid receptors beta and gamma interferes with corepressor recruitment and prevents transcriptional repression.
12554770 2003 Retinoic acid receptors beta and gamma do not repress, but instead activate target gene transcription in both the absence and presence of hormone ligand.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399530 Immunohistochemical localization of the retinoic Acid receptors in human prostate.
12220491 2002 C-H...O hydrogen bonds in the nuclear receptor RARgamma--a potential tool for drug selectivity.
12189556 2002 Retinoids cause apoptosis in pancreatic cancer cells via activation of RAR-gamma and altered expression of Bcl-2/Bax.
11855864 2002 Retinoid signaling is attenuated by proteasome-mediated degradation of retinoid receptors in human keratinocyte HaCaT cells.
10428834 1999 Retinoid-dependent recruitment of a histone H1 displacement activity by retinoic acid receptor.
9865725 1998 Modulation of aromatase expression in the breast tissue by ERR alpha-1 orphan receptor.
9852056 1998 Arg278, but not Lys229 or Lys236, plays an important role in the binding of retinoic acid by retinoic acid receptor gamma.
9501913 1998 Conformational adaptation of agonists to the human nuclear receptor RAR gamma.
9491782 1998 RAR-, not RXR, ligands inhibit cell activation and prevent apoptosis in B-lymphocytes.
9083083 1997 Retinoic acid receptor/retinoid X receptor heterodimers can be activated through both subunits providing a basis for synergistic transactivation and cellular differentiation.
8301142 1994 Retinoic acid inhibition of IL-1-induced IL-6 production by human lung fibroblasts.
7685085 1993 A human retinoic acid receptor gamma isoform is homologous to the murine retinoic acid receptor gamma 7.
7501014 1995 Crystal structure of the RAR-gamma ligand-binding domain bound to all-trans retinoic acid.
2546152 1989 A third human retinoic acid receptor, hRAR-gamma.
2172793 1990 A functional retinoic acid receptor encoded by the gene on human chromosome 12.
2157970 1990 Identification of a novel isoform of the retinoic acid receptor gamma expressed in the mouse embryo.
2157210 1990 Murine isoforms of retinoic acid receptor gamma with specific patterns of expression.
1849262 1991 Genomic organization of the retinoic acid receptor gamma gene.
1655630 1991 Chromosomal assignment of retinoic acid receptor (RAR) genes in the human, mouse, and rat genomes.
1320193 1992 RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites.
1318502 1992 Retinoic acid receptors as regulators of human epidermal keratinocyte differentiation.
1310259 1992 Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently.