Property Summary

NCBI Gene PubMed Count 205
PubMed Score 285.77
PubTator Score 519.30

Knowledge Summary

Patent (75,774)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -5.300 2.3e-09
cystic fibrosis 1.315 1.8e-05
lung carcinoma -1.200 8.2e-09
Breast cancer -1.700 9.6e-13
ovarian cancer 1.100 1.1e-09

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (167)

PMID Text
27011326 Overexpression of miR-146a-5p and miR-146b-5p caused a 31% and 33% decrease in endogenous RARB mRNA levels.
26823825 methylated promoters of DAPK1 combined with MGMT, MGMT combined with RARB, DAPK1 combined with RARB were positive correlated with cervical disease grade
26681652 shows that RAR-beta methylation detected in lung tissue may be used as a predictive marker for non-small cell lung cancer diagnosis and that APC methylation in tumor sample may be a useful marker
26451736 RARbeta2 methylation is significantly increased in breast cancer samples when compared to non-cancerous controls
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
26080448 revealed that HSP70 could directly regulate retinoid acid (RA)-induced retinoid acid receptor beta2 (RARbeta2) gene transcription through its binding to chromatin, with R469me1 being essential in this process
25981383 Curcumin upregulates RARbeta by inhibiting DNMT3b expression which reverses RARbeta promoter methylation.
25970467 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis
25805039 Hypermethylation at promoters of RARB, Dietary folate and cobalamin intake is inversely associated with methylated RARB and BRCA1. High dietary intake of riboflavin and pyridoxine is associated with increased methylation in the RARB promoter.
25684670 Methylated APC and RARbeta2 genes might be valuable serum-based molecular markers for early detection of breast cancer.
25605205 Methylation of the RAR-beta gene with cigarette smoking is associated with non-small cell lung cancer.
25514805 Hypermethylation of RARB was associated with esophageal squamous cell carcinoma.
25422594 in the absence of retinoid signaling via RARbeta, reduced IGF-1 signaling results in suppression of epithelial-mesenchymal transition and delays tumorigenesis induced by the Wnt1 oncogene
25413479 RAR-beta, whereas ATRA alone had no effect on methylation. The RAR-beta gene was reexpressed following DAC-ATRA combination treatment, and both agents had no effect on p16 expression.
25110096 RARbeta2 circulating DNA in lung cancer patients is at greater methylation rate than in healthy donors.
25069511 Analysis indicates that the genes BIRC5, HOXA1 and RARB are critical targets that play an important regulatory role in cervical cancer pathogenesis.
25053593 Our meta-analyses identified strong associations of four aberrantly methylated genes (GSTP1, RASSF1, p16, and RARB) with Prostate cancer
25040980 The total frequency of FHIT, RASSF1A and RARbeta gene methylation was significantly higher in lung cancer.
24953041 These results highlight the relevance of MSK1 in the up-regulation of RARbeta by prostaglandin E2.
24913706 Results suggest that epigenetic alterations of P16INK4A (p16) and retinoic acid receptor beta (RAR-beta) have an important role in ovarian carcinogenesis.
24851851 Data indicate a differential sensitivity of chondral versus endochondral differentiation pathways to retinoic Acid receptor-Beta (RARbeta) signaling.
24796328 promoter methylation may play an important role in carcinogenesis of the NSCLC.
24492483 RARbeta promoter is hypermethylated in all studied prostate tumors and methylation levels are positively correlated with H3K27me3 enrichments.
24414001 RARB and STMN2 polymorphisms were not associated with sporadic CJD in the Korean population.
24075189 Both recessive and dominant mutations in RARB cause anophthalmia.
24050824 The current status of knowledge indicates that there might be inter- or overlapping actions between PPARg and RARs, and there might be an association of PPARg/RARs(RARa, RARb, and RARg) with renal diseases
23969901 Differences in RAR and RXR subtype mRNA expression patterns in various PTCs may contribute to the immunochemistry data available, and may thus find exploitation in clinical oncology, particularly in the differential diagnosis of thyroid neoplasms
23946634 All-trans retinoic acid inhibits human scleral fibroblasts proliferation by a mechanism associated with modulation of ERK 1/2 and JNK activation and depends on stimulation of retinoic acid receptor beta.
23851445 The data suggest that RARbeta and p14ARF may be linked in a signaling pathway that is operating in melanocytic cells and is lost in the majority of melanomas.
23716670 Data show that TLR3 activation by poly I-C induces up-regulation of microRNA-29b, -29c, -148b, and -152 targeting DNA methyltransferases, leading to demethylation and reexpression of the oncosuppressor retinoic acid receptor beta (RARbeta).
23675444 RARbeta2 methylation is associated with the risk of developing prostate cancer. (Meta-analysis)
23644172 EGFR transactivation by intracellular PGE2-activated EP receptors results in the sequential activation of RARbeta and HIF-1alpha
23504373 The highest loss of heterozygosity and/or microsatellite imbalance is revealed in RARB locus in non-small cell lung cancer.
23474497 findings showed that hepatitis C virus Core induced promoter hypermethylation of RAR-beta2 to inhibit its expression; accordingly, Core-expressing cells exhibited resistance to ATRA-induced growth inhibition
23456936 HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early life
23376149 Methylation of the RARB gene increases prostate cancer risk in black Americans.
23299856 Second RARbeta2 loss of expression was found associated with different epigenetic profiles in LNCaP and DU145 cells.
23156677 Significant correlation was found between alterations of methylation status of miR-9-1, miR-9-3, miR-34b/c, miR-193a and the expression level of RAR-beta2 target gene in the primary lung tumors.
23102699 Results define PARG as a coactivator regulating chromatin remodeling during retinoic acid receptor-dependent gene expression.
22967446 RARbeta2 and p16(INK4alpha) hypermethylation was significantly related with pathological stage, lymph node metastasis, and invasion of nerves and vessels in patients with esophageal squamous cell carcinoma.
22964004 HIF-1alpha up-regulation is dependent on intracrine PGE2-RARbeta signalling.
22901127 Low RARbeta expression is associated with advanced gastric cancer.
22694820 In papillary thyroid cancer, significant correlations between the methylation status of the RARbeta2 gene and the V600E BRAF mutation were found.
22693611 nucleolin plays a coregulatory role in transcriptional regulation of the tumor suppressor RARB2 by COUP-TFII
22659417 LMP1 overcomes all-trans retinoic acid-induced apoptosis by repressing RAR-b2 expression via DNA methylation.
22487818 RARbeta gene promoter methylation and P53 mutation were detected in 58.1% and 36.4% of tumors, respectively.
22451234 Significant correlation was observed between promoter hypermethylation of estrogen receptor beta and RARb2 in tumors and paired sera. Breast cancer patients with RARb2 hypermethylation showed higher recurrence and shorter overall survival.
22286019 A significant association was observed between urinary retinoic acid receptor-beta2 gene promoter methylation and hyaluronidase activity and advanced grade tumor.
22116316 trend toward increasing methylation with severity of cervical squamous intraepithelial lesion cytology
21923909 HIV-1 Nef induces loss of F-actin assembly and inhibits retinoid receptor-mediated transcription
21916701 Dietary intakes of folate, vitamins B2, B6, B12, and methionine were not associated with likelihood of promoter methylation of E- cadherin, p16, and RAR-beta2.
21822036 A significant association between high level of RARB methylation and Gleason score (P=0.01) in prostate cancer
21795979 Circulating DNA-based testing verifies RARbeta2 methylation level is significantly increased in plasma from patients with non-small cell lung cancer compared with healthy individuals.
21680534 Methylated RARbeta(2) and APC genes might be valuable urinary molecular markers for early detection of bilharzial and nonbilharzial bladder cancer.
21638515 This work demonstrates a dual role for RARB2 tumor suppression and tumor promotion
21287504 The p16, DAPK and RAR beta genes methylation are strongly associated with clinical data of non-small cell lung cancer, and methylation of p16 and DAPK genes are associated with tobacco smoking.
21254357 One variant in the RARA gene (rs12051734), three variants in the RARB gene (rs6799734, rs12630816, rs17016462), and one variant in the RARG gene (rs3741434) were found to be statistically significant at p < 0.05 as risk factors for meningomyelocele.
21162886 Chemotherapy response in esophageal squamous cell carcinoma is much more effective in RAR-beta positive patients than in RAR-beta negative patients.
20865461 The methylation rate of RAR-beta2 in breast cancer and precancerous lesions of breast cancer were higher than that of normal tissues.
20864173 Data show that methylation of at least one gene was detected in 18 patients (45%), the genes methylated were CDKN2B (20%), RASSF1 (18%), RARB (10%), CDH13 (7.5%) and FHIT (5%).
20711807 New insights into the possible effect of some lifestyle-related factors on the aberrant methylation drift of ERalpha and RARbeta2 genes in breast cancer.
20704749 Combined effects of cigarette smoke and hypermethylations of retinoic acid receptor beta are associated with non small cell lung cancer.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606036 The higher methylation of RARbeta2 genes in prostate tissue samples from AA in comparison with Cau and may potentially contribute to the racial differences that are observed in prostate cancer pathogenesis.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20571967 RARbeta2 was frequently methylated in colorectal cancer and correlated with a worse prognosis and high expression of COX-2 suggesting a link between these two proteins in colorectal carcinogenesis.
20535589 We investigated the utility of a set of four independent genes (P16, TSHR, RASSF1A and RARbeta2) promoter hypermethylation analysis as a diagnostic or prognostic tool in papillary thyroid tumors
20508731 Five single nucleotide polymorphism variants in RARbeta were detected in Chinese subjects with high myopia, none of them were associated significantly with high myopia.
20508731 Observational study of gene-disease association. (HuGE Navigator)
20505321 Data provide evidence that RAR-beta promoter hypermethylation is a major mechanism involved in RAR-beta gene silencing, resulting in impaired RAR-beta function during breast cancer development.
20496080 HIN-1, RAR-beta, RASSF1A, and Twist had the ability to distinguish high-grade squamous intraepithelial lesions/squamous cell carcinomas from low-grade squamous intraepithelial lesions/negative cervical scrapings
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374520 Promoter methylation is responsible for silencing of RAR-beta2 in some melanoma cells and pan-acetylation of H3 likely plays a permissive role in expression of RAR-beta2.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20302734 The expression of RAR-beta decreases significantly in cancer tissues in patients with colorectal cancer. Reduced expression is correlated negatively with the lymph node metastasis and advanced clinicopathological stage.
19961602 RAR-beta2 mRNAs increase signs the normal differentiation of the human bronchial epithelium while a decrease is observed in most lung cancer cell lines
19945765 hypermethylation in tumors from non-small cell lung cancer patients is associated with gender and histologic type
19940364 Promoter hypermethylation was observed in PRB 67%, ERalpha 64%, RASSF1A 63%, p16INK4A 51%, RARbeta2 22%, GSTP1 25% and BRCA1 27% of the breast cancers, respectively.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19829046 DNA hypermethylation of RARbeta2 is associated with inflammatory breast cancer.
19828754 HBx induced promoter hypermethylation of RARbeta2, resulting in downregulation of its expression in hepatocellular carcinoma cells.
19809523 RARbeta and MGMT genes were found to be more frequently methylated in 70.58% and 58.8% of glioblastomas, respectively.
19657672 Findings suggested that aberrant methylation of RARbeta2 occurs frequently in Tunisian breast cancer patients compared with others.
19618401 Data show that methylation of CCND-2, p16, RAR-beta and RASSF-1a was significantly more prevalent in tumor than in normal tissue specimens.
19469866 Our data indicated that RAR beta is expressed in dermatofibrosarcoma protuberans and correlated with COX-2 expression.
19258542 retinoic acid receptor-beta2 has a role in suppression of cyclooxygenase-2 in esophageal neoplasms
19258476 The combination of RARB M4, INK4a/ARF, PRB, and HIN-1 CpG island promoter methylation may predict non-BRCA1/2-associated mammary carcinogenesis and tumor progression.
19221469 Results showed that the inactivation of RASSF1A, RARbeta2 and DAP-Kinase by hypermethylation is a key step in NPC tumorigenesis and progression.
19127267 ATP7A expression is regulated by retinoic acid receptor beta and it has effects on intracellular copper levels, revealing a link between the anticancer action of retinoids and copper metabolism.
19081515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976975 Knockdown of retinoic acid receptor, beta (RARB) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18957410 bexarotene increased the occupancy of the identified enhancer element in IGFBP-6 gene by RXRalpha, RARbeta, cJun, cFos, and p300
18852534 The 5-Aza-deoxycytidine treatment induced RARbetamRNA expression not only in ARO but also in FRO and TT cell lines, whose RARbeta2 promoter was unmethylated.
18825962 Methylation of promoter region of RAR-beta2 gene in renal cell, breast, and ovarian carcinomas
18783461 Promoter region methylation of RARb2 genes is an early event in endometrial carcinogenesis.
18673301 the increase in RAR-beta expression is not associated with telomere shortening, a typical biomarker of cellular senescence
18663751 methylation pattern of the promoter region. We show that hypo- and hypermethylated alleles coexist in 5/11 cell lines in which RARB2 is inactivated.
18547710 reduced expresion in cervical cancer
18538349 The promoter methylation status of a panel of critical growth regulatory genes, RASSF1A, RARbeta2, BRCA1 and HOXA5, in 54 breast cancers and 5 distant normal breast tissues of Indian patients, was analyzed.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18483325 Methylation of RARB was significantly positvely correlated with breast cytologic atypia, increasing between ages 35 and 45.
18349282 Methylation of RARB was present in 80% of NSCLC tissues but only 14% of noncancerous tissues.
18271925 the expression level of RAR beta in endometrial carcinoma is significantly lower than that in endometrial hyperplasia
18254975 Observational study of gene-disease association. (HuGE Navigator)
18212063 TopoIIbeta interacts with the 5' RARE region of the RARbeta gene.
18166136 endogenous expression of retinoids receptor RARbeta gene determines the susceptibility of HCC cells to fenretinide-induced apoptosis
18058812 No field effect, defined as absence of epigenetically transformed cells, for GSTP1 was observed, whereas APC, RARbeta2, and RASSF1A showed a field effect up to 3 mm from the malignant core in three prostatectomy samples.
18036402 Tumor-specific RARB hypermethylation was observed in four papillomas.
17900311 Phosphorylation of RXRalpha abolishes its ability to form homodimers and heterodimers with RXR and retinoic acid receptor beta.
17804711 HOXA5 acts directly downstream of RARbeta and may contribute to retinoid-induced anticancer and chemopreventive effects.
17686773 ectopic expression of RAR beta2 is able to down-regulate HPV-18 transcription by selectively abrogating the binding of AP-1 to the viral regulatory region in a ligand-independent manner.
17615267 RARss is downregulated upon TGF-ss3-driven chondrogenic differentiation of adult bone marrow mesenchymal stem cells. RARss chondrogenic pathway is independent of upregulation in SOX9 and does not lead to hypertrophy.
17556535 Shows a higher methylation in all six patients with familial partial lipodystrophy when compared with progeria patients with other LMNA mutations as well as the healthy controls.
17549354 Hypopharynx tumors showed significantly lower hypermethylation and higher mRNA expression levels of RAR beta2 compared to the tumors located at other sites of the head and neck
17252005 Biological properties of the other RAR isoforms (RARbeta and RARgamma), through the generation pf fusion protein isoforms in acutte promyelocytic leukemia.
17244680 RARbeta2 is commonly silenced by hypermethylation in primary AML blasts but not in normal hematopoietic precursors.
17065567 Immunohistochemistry (demonstrated no overt difference between CDH, hypoplastic, and control lungs, either in the localization nor the timing of the first expression of glucocorticoid, retinoid, and thyroid hormone receptors
17001699 Results suggest that the truncated form of retinoic acid receptor beta induces retinoid resistance rather than sensitivity, and alternative pathways of cell death are mediated by different isoforms in breast cancer cells.
16858683 Aberrant methylation and hence silencing of TIMP3, SLC5A8, DAPK and RARbeta2, in association with BRAF mutation, may be an important step in PTC tumorigenesis and progression.
16613851 MOZ-TIF2 associates with the RARbeta2 promoter in vivo, resulting in altered recruitment of CBP/p300, aberrant histone modification, and down-regulation of the RARbeta2 gene
16478744 RARbeta2 was methylated in the tumor epithelium of all five prostate cancer patients and in the tumor-associated stroma in four of the five patients.
16389900 Genetically deregulated in cerebral glioma. (review)
16288117 In H358 lung cancer cells transiently transfected with RARbeta1', RA treatment restored target gene expression compared with that in vector-transfected cells and suppressed cell growth compared with that in untreated cells.
16287870 RARbeta2 silencing and retinoic acid (RA) resistance are consequent to an impaired integration of RA signal at RARbeta2 chromatin
16255778 RARbeta2 induces a number of tumor suppressor functions and metastasis suppressors
16244585 Study demonstrate for the first time a significant and specific overexpression of RAR-beta(1) in chromophobe renal cell carcinoma
16134180 Hypermethylation of retinoid acid receptor beta is associated with gastric carcinogenesis
16128742 results show that inactivation of the retinoic acid signaling-associated genes RAR-beta, CRBP1, and TIG1 by DNA methylation occurs frequently in esophageal squamous cell carcinoma
15635645 Observational study of gene-disease association. (HuGE Navigator)
15502323 crystal structure of retinoic acid receptor beta
15467435 Increased acetylation of RARbeta1 is associated with head and neck cancer
15383624 (RAR)beta functions as a tumor suppressor gene in various contexts where its absence is associated with tumorigenicity and its presence causes cell cycle arrest.
15375805 Review loss or abnormality of RAR-b in lung cancer cell lines. It may have tumor suppression function.
15361842 RARbeta2 acts as a tumor suppressor gene in myelofibrosis with myeloid metaplasia and epigenetic changes are the most significant determinants of RARbeta2 gene activity in these patients.
15255287 Loss of expression of RARbeta is associated with esophageal squamous cell carcinomas
15217932 RARbeta2 methylation has a role in development of prostate neoplasms
15217922 Retinoic acid receptor beta2 hypermethylation has a role in prostate cancer [editorial]
15014026 RAR-beta(2) silencing by methylation is an early event in head and neck carcinogenesis.
14726690 Isoforms are involved in colon cancer cell growth.
14726683 The adult RARbeta2 isoform also shows age-related methylation in normal tissues but more variable methylation in colorectal cancer.
14691372 In a 9-cis retinoic acid-dependent fashion in cells in vitro, retinoic acid receptor beta isoform stimulates the expression of reporter constructs containing the site that binds aldehyde dehydrogenase-2.
14614007 Hypermethylation-associated inactivation of retinoic acid receptor beta is associated with esophageal squamous cell carcinoma
14601057 hypermethylated in invasive and in in situ lobular breast cancer
12839965 Promoter hypermethylation of this gene is demonstrated in esophageal squamous cell carcinoma.
12839938 The regulatin oexpression of this receptor in cancer cells is affected by ligands of ppargamma.
12805409 c-myc, FOG1, GATA6, glutamate dehydrogenase, glutathione S-transferase homologue (p28), Foxq1, Hic5, Meis1a, Dab2, midkine, and the PDGF-alpha receptor are genes regulated specifically by RARbeta(2) in F9 cells
12789467 the role of RAR-beta2 induction with respect to clonogenic survival of different human tumor cells under retinoid treatment alone or in combination with irradiation
12665583 RAR beta and RAR gamma receptors appear to adopt a constitutively closed helix 12 conformation in the absence of hormone that may approximate the conformation of RAR alpha when bound to hormone agonist.
12579317 ATRA increased RARbeta2 mRNA in non-metastatic breast cancer cells. The same treatment of metastatic cells resulted in an increase in RARbeta4 & a decrease in RARbeta2 mRNA. RARbeta4 may contribute to metastatic properties of breast cancer cell lines.
12576329 results suggest that oxidized phospholipids inhibit transcription of the thrombomodulin gene in vascular endothelium by inhibiting the binding of retinoic acid receptor beta-retinoid x receptor alpha heterodimer and Sp1 and Sp3 to thrombomodulin promoter
12554770 RARbeta and RARgamma interact only weakly with SMRT.
12529350 RARbeta expression may be an indicator of increased risk of lung cancer in heavy smokers.
12399530 Present only in basal epithelial nuclei. RAR-beta and -gamma were increased in basal and luminal epithelial nuclei in glands with benign prostatic hyperplasia.
12191570 STAT-1, IRF-1, and RAR-beta expression were enhanced by IFN-gamma and ATRA in combination, and to a greater degree in BALM-3 cells than in BALM-1 cells, suggesting that these IFN-gamma related genes were involved in the induction of apoptosis.
12124324 Loss of retinoic acid receptor beta gene expression is linked to aberrant histone H3 acetylation in lung cancer cell lines.
12118004 downstream codons in mRNAs initiate translation of a protein isoform that disrupts retinoid-activated transcription
12009305 Results show that both RARalpha and RARbeta are mediators in the anticancer function of All-trans retinoic acid via AP-1 activity inhibition.
11980632 Endogenous reactivation of the RARbeta2 tumor suppressor gene epigenetically silenced in breast cancer.
11945179 Methylation of the 5' region of RAR-beta 2 gene may contribute to gene silencing and may be an important and early event in cervical carcinogenesis.
11925591 Results indicate that loss of RAR-beta expression and accumulation of p 53 and Ki67 proteins may serve as biomarkers for early identification of esophageal cancer in the high-risk populations.
11839665 distinct methylation pattern in bladder cancer with frequent methylation of RARbeta, DAPK, E-cadherin, and p16.
11834837 PML-RAR fusion protein induces gene hypermethylation and silencing by recruiting DNA methyltransferases to the RARbeta2 promoter
11769677 The expression of exogenous hRAR beta gene in HL-60R cells could resume their sensitivity to retionoids in inhibiting cell proliferation and inducing granulocytic differentiation.

AA Sequence

MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEE      1 - 70
LVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTT    141 - 210
NSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDK    281 - 350
LQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH    351 - 420
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ                                       421 - 455
//

Text Mined References (206)

PMID Year Title
27011326 2016 Family of microRNA-146 Regulates RAR? in Papillary Thyroid Carcinoma.
26823825 2015 DAPK1, MGMT and RARB promoter methylation as biomarkers for high-grade cervical lesions.
26681652 2016 Promoter methylation of APC and RAR-? genes as prognostic markers in non-small cell lung cancer (NSCLC).
26451736 2015 Promoter Methylation of the Retinoic Acid Receptor Beta2 (RAR?2) Is Associated with Increased Risk of Breast Cancer: A PRISMA Compliant Meta-Analysis.
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
26080448 2015 Arginine methylation of HSP70 regulates retinoid acid-mediated RAR?2 gene activation.
25981383 2015 Curcumin Reactivates Silenced Tumor Suppressor Gene RAR? by Reducing DNA Methylation.
25970467 2015 Retinoic acid receptor beta and angiopoietin-like protein 1 are involved in the regulation of human androgen biosynthesis.
25805039 2015 Association of folate and other one-carbon related nutrients with hypermethylation status and expression of RARB, BRCA1, and RASSF1A genes in breast cancer patients.
25684670 2015 Aberrant methylation of APC and RAR?2 genes in breast cancer patients.
25605205 2014 Association of methylation of the RAR-? gene with cigarette smoking in non-small cell lung cancer with Southern-Central Chinese population.
25422594 2014 Inactivation of RAR? inhibits Wnt1-induced mammary tumorigenesis by suppressing epithelial-mesenchymal transitions.
25416956 2014 A proteome-scale map of the human interactome network.
25413479 2015 Retinoic acid receptor-? gene reexpression and biological activity in SHI-1 cells after combined treatment with 5-aza-2'-deoxycytidine and all-trans retinoic acid.
25110096 2014 MIRA analysis of RAR?2 gene methylation in DNA circulating in the blood in lung cancer.
25069511 2014 Identification of critical microRNA gene targets in cervical cancer using network properties.
25053593 2014 Meta-analyses of methylation markers for prostate cancer.
25040980 2014 Combined effects methylation of FHIT, RASSF1A and RAR? genes on non-small cell lung cancer in the Chinese population.
24953041 2014 Prostaglandin E2 induces retinoic acid receptor-? up-regulation through MSK1.
24913706 2014 Epigenetic alteration of p16 and retinoic acid receptor beta genes in the development of epithelial ovarian carcinoma.
24851851 2014 Regulating chondrogenesis of human mesenchymal stromal cells with a retinoic Acid receptor-Beta inhibitor: differential sensitivity of chondral versus osteochondral development.
24796328 2014 A meta-analysis of the relationship between RAR? gene promoter methylation and non-small cell lung cancer.
24492483 2014 Synergistic chromatin repression of the tumor suppressor gene RARB in human prostate cancers.
24414001 2014 RARB and STMN2 polymorphisms are not associated with sporadic Creutzfeldt-Jakob disease (CJD) in the Korean population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24075189 2013 Recessive and dominant mutations in retinoic acid receptor beta in cases with microphthalmia and diaphragmatic hernia.
24050824 2013 Association of peroxisome proliferator-activated receptors/retinoic acid receptors with renal diseases.
23969901 2013 mRNA expression pattern of retinoic acid and retinoid X nuclear receptor subtypes in human thyroid papillary carcinoma.
23946634 2013 All-trans retinoic acid modulates mitogen-activated protein kinase pathway activation in human scleral fibroblasts through retinoic acid receptor beta.
23851445 2013 Mutual exclusivity analysis of genetic and epigenetic drivers in melanoma identifies a link between p14 ARF and RAR? signaling.
23716670 2013 Toll-like receptor 3 (TLR3) activation induces microRNA-dependent reexpression of functional RAR? and tumor regression.
23675444 2013 The association of retinoic acid receptor beta2(RAR?2) methylation status and prostate cancer risk: a systematic review and meta-analysis.
23644172 2013 Epidermal growth factor receptor transactivation by intracellular prostaglandin E2-activated prostaglandin E2 receptors. Role in retinoic acid receptor-? up-regulation.
23504373 2013 Significant frequency of allelic imbalance in 3p region covering RAR? and MLH1 loci seems to be essential in molecular non-small cell lung cancer diagnosis.
23474497 2013 Hepatitis C virus Core protein overcomes all-trans retinoic acid-induced cell growth arrest by inhibiting retinoic acid receptor-?2 expression via DNA methylation.
23456936 2013 HHIP, HDAC4, NCR3 and RARB polymorphisms affect fetal, childhood and adult lung function.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376149 2013 Methylation of the RARB gene increases prostate cancer risk in black Americans.
23299856 2013 DNA methylation associated with polycomb repression in retinoic acid receptor ? silencing.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23156677 [Methylation of some miRNA genes is involved in the regulation of their target genes RAR-beta2 and NKIRAS1 expression in lung cancer].
23102699 2012 Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression.
22967446 2012 [DNA methylation status of RAR?2 and p16(INK4?) in peripheral blood and tumor tissue in patients with esophageal squamous cell carcinoma].
22964004 2012 Intracrine prostaglandin E(2) signalling regulates hypoxia-inducible factor-1? expression through retinoic acid receptor-?.
22901127 2012 Retinoid receptors in gastric cancer: expression and influence on prognosis.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22694820 2012 Correlation between BRAF mutation and promoter methylation of TIMP3, RAR?2 and RASSF1A in thyroid cancer.
22693611 2012 Identification and characterization of nucleolin as a COUP-TFII coactivator of retinoic acid receptor ? transcription in breast cancer cells.
22659417 2012 Epstein-Barr Virus latent membrane protein 1 overcomes all-trans retinoic acid-induced apoptosis by inhibiting retinoic acid receptor-?? expression.
22487818 2012 [Correlation between RARbeta gene promoter methylation and P53 gene mutations in non-small cell lung cancer].
22451234 2012 Clinical significance of promoter hypermethylation of ER? and RAR?2 in tumor and serum DNA in Indian breast cancer patients.
22286019 2012 Urinary retinoic acid receptor-?2 gene promoter methylation and hyaluronidase activity as noninvasive tests for diagnosis of bladder cancer.
22116316 2012 Population-based case-control study on DAPK1, RAR-?2 and MGMT methylation in liquid-based cytology.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21916701 2011 Promoter methylation of E-cadherin, p16, and RAR-?(2) genes in breast tumors and dietary intake of nutrients important in one-carbon metabolism.
21822036 2011 Frequent methylation of RASSF1 and RARB in urine sediments from patients with early stage prostate cancer.
21795979 2011 RAR?2 gene methylation level in the circulating DNA from blood of patients with lung cancer.
21680534 2011 Aberrant methylation of RARbeta2 and APC genes in voided urine as molecular markers for early detection of bilharzial and nonbilharzial bladder cancer.
21638515 2011 Knockdown of RARB2 identifies a dual role in cancer.
21287504 2011 [Relationship between promoter methylation of p16, DAPK and RAR beta genes and the clinical data of non-small cell lung cancer].
21254357 2011 Association of retinoic acid receptor genes with meningomyelocele.
21162886 2010 [The relationship between retinoic acid receptor-? expression and chemotherapy response in esophageal squamous cell carcinoma].
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20865461 2011 Epigenetic regulation of retinoic acid receptor ?2 gene in the initiation of breast cancer.
20864173 2011 Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts.
20711807 2010 The effect of modifiable potentials on hypermethylation status of retinoic acid receptor-beta2 and estrogen receptor-alpha genes in primary breast cancer.
20704749 2010 Combined effects of cigarette smoking, gene polymorphisms and methylations of tumor suppressor genes on non small cell lung cancer: a hospital-based case-control study in China.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606036 2010 Identification of differentially methylated genes in normal prostate tissues from African American and Caucasian men.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20571967 2010 Hypermethylation of RAR?2 correlates with high COX-2 expression and poor prognosis in patients with colorectal carcinoma.
20535589 2011 Qualitative and quantitative promoter hypermethylation patterns of the P16, TSHR, RASSF1A and RAR?2 genes in papillary thyroid carcinoma.
20508731 2010 Association analysis of retinoic acid receptor beta (RARbeta) gene with high myopia in Chinese subjects.
20505321 2010 Basal-like breast cancer displays distinct patterns of promoter methylation.
20496080 2010 Quantitative assessment of DNA methylation for the detection of cervical neoplasia in liquid-based cytology specimens.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374520 2010 Silencing and re-expression of retinoic acid receptor beta2 in human melanoma.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20302734 2010 [Expression and its significance of retinoic acid receptor-beta in colorectal cancer].
19961602 2009 Signalling with retinoids in the human lung: validation of new tools for the expression study of retinoid receptors.
19945765 2010 DNA hypermethylation of tumors from non-small cell lung cancer (NSCLC) patients is associated with gender and histologic type.
19940364 2009 Prognostic relevance of promoter hypermethylation of multiple genes in breast cancer patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19829046 2009 Quantitative assessment of DNA hypermethylation in the inflammatory and non-inflammatory breast cancer phenotypes.
19828754 2010 Hepatitis B virus X protein overcomes the growth-inhibitory potential of retinoic acid by downregulating retinoic acid receptor-beta2 expression via DNA methylation.
19809523 High incidence of MGMT and RARbeta promoter methylation in primary glioblastomas: association with histopathological characteristics, inflammatory mediators and clinical outcome.
19657672 2010 Aberrant methylation of RASSF1A is associated with poor survival in Tunisian breast cancer patients.
19618401 2010 Quantitative evaluation of DNA hypermethylation in malignant and benign breast tissue and fluids.
19553259 2009 Common body mass index-associated variants confer risk of extreme obesity.
19469866 2009 Expression of retinoic acid receptor beta in dermatofibrosarcoma protuberans.
19443732 2009 Epithelial cells in fetal intestine produce chemerin to recruit macrophages.
19345331 2009 ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome.
19258542 2009 Antitumor effect of retinoic acid receptor-beta2 associated with suppression of cyclooxygenase-2.
19258476 2009 CpG island tumor suppressor promoter methylation in non-BRCA-associated early mammary carcinogenesis.
19221469 2009 Inactivation of RASSF1A, RARbeta2 and DAP-kinase by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma.
19127267 2009 ATP7A is a novel target of retinoic acid receptor beta2 in neuroblastoma cells.
19081515 2009 Genetic risk factors for variant Creutzfeldt-Jakob disease: a genome-wide association study.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18957410 2009 Rexinoid-induced expression of IGFBP-6 requires RARbeta-dependent permissive cooperation of retinoid receptors and AP-1.
18852534 2008 Retinoic acid receptor beta2 re-expression and growth inhibition in thyroid carcinoma cell lines after 5-aza-2'-deoxycytidine treatment.
18845237 2009 Retinoic acid regulates the human methionine sulfoxide reductase A (MSRA) gene via two distinct promoters.
18825962 2008 [Methylation of promoter region of RAR-beta2 gene in renal cell, breast, and ovarian carcinomas].
18783461 2008 High frequency of RASSF1A and RARb2 gene promoter methylation in morphologically normal endometrium adjacent to endometrioid adenocarcinoma.
18673301 2008 An RPE cell line as a useful in vitro model for studying retinoic acid receptor beta: expression and affinity.
18663751 2008 Allelic methylation bias of the RARB2 tumor suppressor gene promoter in cancer.
18547710 2008 Expression of RAR beta2 gene by real-time RT-PCR: differential expression in normal subjects compared to cervical cancer patients normalised against GAPDH as a housekeeping gene.
18538349 2008 Clinical significance of promoter hypermethylation of RASSF1A, RARbeta2, BRCA1 and HOXA5 in breast cancers of Indian patients.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18483325 2008 DNA methylation in benign breast epithelium in relation to age and breast cancer risk.
18349282 2008 DNA methylation in tumor and matched normal tissues from non-small cell lung cancer patients.
18271925 2008 Expression of retinoic acid receptors in human endometrial carcinoma.
18254975 2008 Physiogenomic comparison of human fat loss in response to diets restrictive of carbohydrate or fat.
18212063 2008 Topoisomerase IIbeta negatively modulates retinoic acid receptor alpha function: a novel mechanism of retinoic acid resistance.
18166136 2007 Fenretinide-induced apoptosis of Huh-7 hepatocellular carcinoma is retinoic acid receptor beta dependent.
18058812 2008 Quantitative, spatial resolution of the epigenetic field effect in prostate cancer.
18036402 2007 DNA methylation patterns of the CDH1, RARB, and SFN genes in choroid plexus tumors.
17900311 2007 Phosphorylated retinoid X receptor alpha loses its heterodimeric activity with retinoic acid receptor beta.
17804711 2007 HOXA5 acts directly downstream of retinoic acid receptor beta and contributes to retinoic acid-induced apoptosis and growth inhibition.
17686773 2007 Retinoic acid receptor beta silences human papillomavirus-18 oncogene expression by induction of de novo methylation and heterochromatinization of the viral control region.
17615267 2007 Pharmacological regulation of adult stem cells: chondrogenesis can be induced using a synthetic inhibitor of the retinoic acid receptor.
17556535 2007 The retinol acid receptor B gene is hypermethylated in patients with familial partial lipodystrophy.
17549354 2007 RAR beta2 suppression in head and neck squamous cell carcinoma correlates with site, histology and age.
17252005 2007 A redundant oncogenic potential of the retinoic receptor (RAR) alpha, beta and gamma isoforms in acute promyelocytic leukemia.
17244680 2007 Heterochromatic gene repression of the retinoic acid pathway in acute myeloid leukemia.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
17065567 2006 Spatial and temporal expression of glucocorticoid, retinoid, and thyroid hormone receptors is not altered in lungs of congenital diaphragmatic hernia.
17001699 2006 Truncated RAR beta isoform enhances proliferation and retinoid resistance.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16858683 2006 Association of aberrant methylation of tumor suppressor genes with tumor aggressiveness and BRAF mutation in papillary thyroid cancer.
16613851 2006 MOZ-TIF2 alters cofactor recruitment and histone modification at the RARbeta2 promoter: differential effects of MOZ fusion proteins on CBP- and MOZ-dependent activators.
16478744 2006 Gene promoter methylation in prostate tumor-associated stromal cells.
16389900 2005 [Methylation status of RARbeta gene promoter in low and high grade cerebral glioma. Comparison with normal tissue. Immuno-histochemical study of nuclear RARbeta expression in low and high grade cerebral glioma cells. Comparison with normal cells. 48 tumors].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16288117 2005 A novel retinoic acid receptor beta isoform and retinoid resistance in lung carcinogenesis.
16287870 2005 Impaired retinoic acid (RA) signal leads to RARbeta2 epigenetic silencing and RA resistance.
16255778 2005 Antimetastatic gene expression profiles mediated by retinoic acid receptor beta 2 in MDA-MB-435 breast cancer cells.
16244585 2005 RAR-beta(1) overexpression in chromophobe renal cell carcinoma: a novel target for therapeutic intervention?
16134180 2005 DNA methylation of genes linked with retinoid signaling in gastric carcinoma: expression of the retinoid acid receptor beta, cellular retinol-binding protein 1, and tazarotene-induced gene 1 genes is associated with DNA methylation.
16128742 2005 DNA methylation of genes linked to retinoid signaling in squamous cell carcinoma of the esophagus: DNA methylation of CRBP1 and TIG1 is associated with tumor stage.
15635645 2005 Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.
15604252 2004 A novel RARbeta isoform directed by a distinct promoter P3 and mediated by retinoic acid in breast cancer cells.
15558014 2005 Identification of novel RARbeta2 transcript variants with short 5'-UTRs in normal and cancerous breast epithelial cells.
15502323 2004 RARbeta ligand-binding domain bound to an SRC-1 co-activator peptide: purification, crystallization and preliminary X-ray diffraction analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467435 2004 Regulation of RARbeta1 expression in head and neck cancer cells by cell density-dependent chromatin remodeling.
15383624 2004 A retinoic acid receptor beta/gamma-selective prodrug (tazarotene) plus a retinoid X receptor ligand induces extracellular signal-regulated kinase activation, retinoblastoma hypophosphorylation, G0 arrest, and cell differentiation.
15375805 Chemoprevention in lung cancer.
15361842 2004 RARbeta2 is a candidate tumor suppressor gene in myelofibrosis with myeloid metaplasia.
15255287 2004 Differential expression of retinoic acid receptors in normal and malignant esophageal tissues.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15217932 2004 Quantitative RARbeta2 hypermethylation: a promising prostate cancer marker.
15217922 2004 Retinoic acid receptor beta2 hypermethylation: implications for prostate cancer detection, prevention, and therapy.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
15014026 2004 Hypermethylation of the retinoic acid receptor-beta(2) gene in head and neck carcinogenesis.
14726690 2004 Retinoic acid receptor beta and colon cancer.
14726683 2004 Methylation and regulation of expression of different retinoic acid receptor beta isoforms in human colon cancer.
14691372 2003 Identification of a retinoid receptor response element in the human aldehyde dehydrogenase-2 promoter.
14614007 2003 Hypermethylation-associated inactivation of retinoic acid receptor beta in human esophageal squamous cell carcinoma.
14601057 2003 DNA methylation of RASSF1A, HIN-1, RAR-beta, Cyclin D2 and Twist in in situ and invasive lobular breast carcinoma.
12839965 2003 Allele loss and promoter hypermethylation of VHL, RAR-beta, RASSF1A, and FHIT tumor suppressor genes on chromosome 3p in esophageal squamous cell carcinoma.
12839938 2003 Regulation of retinoic acid receptor beta expression by peroxisome proliferator-activated receptor gamma ligands in cancer cells.
12805409 2003 Identification and characterization of retinoic acid receptor beta2 target genes in F9 teratocarcinoma cells.
12789467 2003 Sensitivity of human tumor cells to retinoids or combined treatment with retinoids and ionizing radiation is not dependent on RAR-beta 2 induction.
12665583 2003 Isotype-restricted corepressor recruitment: a constitutively closed helix 12 conformation in retinoic acid receptors beta and gamma interferes with corepressor recruitment and prevents transcriptional repression.
12579317 2003 Differential effects of retinoic acid on the growth of isogenic metastatic and non-metastatic breast cancer cell lines and their association with distinct expression of retinoic acid receptor beta isoforms 2 and 4.
12576329 2003 Oxidized phospholipids in oxidized low-density lipoprotein down-regulate thrombomodulin transcription in vascular endothelial cells through a decrease in the binding of RARbeta-RXRalpha heterodimers and Sp1 and Sp3 to their binding sequences in the TM promoter.
12554770 2003 Retinoic acid receptors beta and gamma do not repress, but instead activate target gene transcription in both the absence and presence of hormone ligand.
12529350 2003 Retinoic acid receptor beta and telomerase catalytic subunit expression in bronchial epithelium of heavy smokers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399530 Immunohistochemical localization of the retinoic Acid receptors in human prostate.
12191570 2002 Human B-cell lymphoma cell lines are highly sensitive to apoptosis induced by all-trans retinoic acid and interferon-gamma.
12118004 2002 Downstream codons in the retinoic acid receptor beta -2 and beta -4 mRNAs initiate translation of a protein isoform that disrupts retinoid-activated transcription.
12009305 2002 Anticancer effect of retinoic acid via AP-1 activity repression is mediated by retinoic acid receptor alpha and beta in gastric cancer cells.
11945179 2002 Methylation and silencing of the retinoic acid receptor-beta 2 gene in cervical cancer.
11925591 2002 The abnormal expression of retinoic acid receptor-beta, p 53 and Ki67 protein in normal, premalignant and malignant esophageal tissues.
11839665 2002 Hypermethylation of multiple genes in tumor tissues and voided urine in urinary bladder cancer patients.
11834837 2002 Methyltransferase recruitment and DNA hypermethylation of target promoters by an oncogenic transcription factor.
11769677 2001 [The role of exogenous hRAR beta gene on the growth inhibition and differentiation induction of HL-60R Cells].
10411930 1999 Elevated retinoic acid receptor beta(4) protein in human breast tumor cells with nuclear and cytoplasmic localization.
10198169 1999 Linkage of the nuclear hormone receptor genes NR1D2, THRB, and RARB: evidence for an ancient, large-scale duplication.
9005841 1996 Biosynthesis and function of all-trans- and 9-cis-retinoic acid in parathyroid cells.
8950166 1996 Structure of the human retinoic acid receptor beta 1 gene.
8754792 1996 Molecular cloning and properties of a full-length putative thyroid hormone receptor coactivator.
8707417 1996 Different ligand responsiveness of human retinoic-acid-receptor beta-gene transcription in tumorigenic and non-tumorigenic cervical-carcinoma-derived cell lines is mediated through a large retinoic-acid-response domain.
8612722 1995 Localization of retinoic acid receptors in anterior-human embryo.
8383553 1993 The solution structure of the human retinoic acid receptor-beta DNA-binding domain.
8275470 1994 Fetal isoform of human retinoic acid receptor beta expressed in small cell lung cancer lines.
7628539 1995 Effect of cellular senescence and retinoic acid on the expression of cellular retinoic acid binding proteins in skin fibroblasts.
7565739 1995 Adenovirus E1A functions as a cofactor for retinoic acid receptor beta (RAR beta) through direct interaction with RAR beta.
3014347 1986 Hepatitis B virus DNA integration in a sequence homologous to v-erb-A and steroid receptor genes in a hepatocellular carcinoma.
2844650 1988 Assignment of the human hap retinoic acid receptor RAR beta gene to the p24 band of chromosome 3.
2836738 1988 A new retinoic acid receptor identified from a hepatocellular carcinoma.
2833708 1988 Identification of a second human retinoic acid receptor.
2825037 1987 A novel steroid thyroid hormone receptor-related gene inappropriately expressed in human hepatocellular carcinoma.
2542014 1989 Differential expression and ligand regulation of the retinoic acid receptor alpha and beta genes.
2177841 1990 A retinoic acid receptor-specific element controls the retinoic acid receptor-beta promoter.
2170809 1990 Hepatitis B virus as an insertional mutagene in a human hepatocellular carcinoma.
2153268 1990 Identification of a retinoic acid responsive element in the retinoic acid receptor beta gene.
1663808 1991 Mouse and human retinoic acid receptor beta 2 promoters: sequence comparison and localization of retinoic acid responsiveness.
1379266 1992 The expression of retinoic acid receptors in cultured human endometrial stromal cells and effects of retinoic acid.
1332705 1992 Genomic organization of the human retinoic acid receptor beta 2.
1331778 1992 Heterodimerization among thyroid hormone receptor, retinoic acid receptor, retinoid X receptor, chicken ovalbumin upstream promoter transcription factor, and an endogenous liver protein.
1321662 1992 Homo- and heteronuclear NMR studies of the human retinoic acid receptor beta DNA-binding domain: sequential assignments and identification of secondary structure elements.
1313565 1992 RAR-beta 4, a retinoic acid receptor isoform is generated from RAR-beta 2 by alternative splicing and usage of a CUG initiator codon.