Property Summary

NCBI Gene PubMed Count 290
PubMed Score 890.62
PubTator Score 1059.89

Knowledge Summary

Patent (71,249)

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer -1.200 2.5e-03
osteosarcoma 1.292 1.7e-04
glioblastoma 2.400 4.4e-02
primitive neuroectodermal tumor 1.200 2.2e-03
type 2 diabetes 1.336 7.8e-03
tuberculosis -1.100 1.5e-04
adult high grade glioma 2.500 1.7e-02
atypical teratoid/rhabdoid tumor 1.500 3.8e-02
group 4 medulloblastoma 2.500 4.8e-02
pilocytic astrocytoma 1.400 1.7e-06
posterior fossa group A ependymoma 1.200 9.0e-07
non primary Sjogren syndrome sicca 1.100 1.5e-02
psoriasis -1.100 3.6e-12
pituitary cancer -1.200 8.2e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (188)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
26969398 down-regulation of the level of RAR alpha leads to increased expression of VDR in acute myeloid leukemia.
26728137 ATRA dramatically down regulated RARalpha protein levels and led to more DNA damage and ultimately resulted in the synergism of these two agents
26537301 Novel insight into the functional difference of acquired mutations of PML-RARA both in vitro and in the clinical setting.
26469385 HIV-1 MA upregulates RARA gene expression in HepG2 cells
26294332 The PML-region mutations were associated with response to Arsenic trioxide-based therapy (P < 0.0001), number of relapses (P = 0.001), and early relapse (P = 0.013)in acute promyelocytic leukemia patients.
26213848 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RARalpha protein degradation in acute promyelocytic leukemia.
26088929 our findings challenge the predominant model in the field and we propose that PML/RARA initiates leukemia by subtly shifting cell fate decisions within the promyelocyte compartment.
26041820 Data show that the tumor suppressor RASSF1A is a direct target of the PML/RARalpha-regulated microRNAs miR-181a/b cluster.
26026090 bortezomib impairs the UPS that controls normal protein homeostasis by causing excessive accumulation of PML-RARA augmenting ER stress and leading to acute promyelocytic leukemia cell death
25791120 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NFkappaB and JNK
25680531 Human miR-138 promotes tau phosphorylation by directly targeting the RARA and the associated GSK-3beta pathway.
25550158 Data indicate that retinoic acid receptor (RAR) is crucial for regulating sodium taurocholate cotransporting polypeptide (NTCP) expression that determines permissiveness to hepatitis B virus (HBV) infection.
25300573 These results suggest that overexpression of RARA enhances malignant transformation during mammary tumorigenesis.
25275592 CDKN2D repression by PML/RARalpha disrupts both cell proliferation and differentiation in the pathogenesis of acute promyelocytic leukemia.
25071154 Results show that UTX interacts with the retinoic acid receptor alpha (RARalpha) and this interaction is essential for proper differentiation of leukemic U937 cells in response to retinoic acid.
25033841 This study identifies a novel mechanism through which NPM-RAR affects leukemogenesis
24992177 RARalpha might be involved in the pathogenesis of varicocele as its expression is reduced in pathologic samples.
24819975 SUMO-1 modification of RARA is a potent mechanism for balancing proliferation and differentiation by controlling the stability of RARA in cancer cells.
24806185 The presence of a mutation in the arsenic-binding domain of PML-RARA led to arsenic resistance in patients with acute promyelocytic leukemia.
24711541 PML-RARalpha cooperates with HIF-1alpha to activate a pro-leukemogenic program.
24608861 E2F1 is found to downregulate retinoic acid receptor alpha (RARalpha), a key factor determines the effectiveness of all-trans retinoic acid.
24516348 Down-regulation of NLS-RARalpha expression inhibited the proliferation and induced the differentiation of HL-60 cells. On the contrary, over-expression of NLS-RARa promoted proliferation and reduced the ATRA-induced differentiation of HL-60 cells.
24394593 provide evidence for the existence of a functional ternary complex containing TDG, CBP and activated RARalpha
24264050 OSTbeta is a target of RARalpha-mediated (by binding to DR5 response element) gene regulation pathways
24183235 RXR interaction is necessary for NPM-RAR-mediated myeloid maturation arrest.
24050824 The current status of knowledge indicates that there might be inter- or overlapping actions between PPARg and RARs, and there might be an association of PPARg/RARs(RARa, RARb, and RARg) with renal diseases
24038216 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL.
23969901 Differences in RAR and RXR subtype mRNA expression patterns in various PTCs may contribute to the immunochemistry data available, and may thus find exploitation in clinical oncology, particularly in the differential diagnosis of thyroid neoplasms.
23927396 These results indicate that NPM-RAR, not RAR-NPM, is the prime mediator of myeloid differentiation arrest in t(5;17) APL.
23898169 RARalpha-PLZF fusion protein inhibits myeloid cell differentiation through interactions with C/EBPalpha tethered to DNA in acute promyelocytic leukemia.
23868472 Retinoic acid receptor alpha may be a novel therapeutic target and a predictive factor for estrogen receptor alpha-positive breast cancer patients treated with adjuvant tamoxifen.
23847194 RARalpha2 has a role in determining myeloma stem cell features in mouse and human cells
23782583 an association between polymorphisms of RARA gene and some of some common adverse effects of oral isotretinoin in acne patients
23775127 CTBP2 is a transcriptional cofactor for RXR-alpha/RAR-alpha.
23770850 PML/RARalpha suppresses PU.1-dependent activation of the proteasome immunosubunits in acute promyelocytic leukemia.
23612809 The objective was to describe the frequency of molecular subtypes of PML/RARalpha in patients with acute promyelocytic leukemia (APL) and their distribution according to risk of recurrence and cytomorphology
23474897 Data indicate antagonism to retinoic acid receptor alpha (RARalpha) for both synthesized chromene analog compounds.
23448850 Studies indicate that initiation of leukemogenesis by PML-RARalpha occurs independently from DNA methylation.
23271512 STAT5-RARA positive acute promyelocytic leukemia variant is unresponsive to both all trans retinoic acid and arsenic trioxide.
23102699 Results define PARG as a coactivator regulating chromatin remodeling during retinoic acid receptor-dependent gene expression.
23064710 detection of double-stranded polymerase chain reaction (PCR) products of PML/RARalpha fusion gene in acute promyelocytic leukemia (APL)
23064648 The RAR-dependent and Pol III-dependent DR2 Alu transcriptional events in stem cells functionally complement the Pol II-dependent neuronal transcriptional program.
22982005 analysis of a cryptic PML-RARA translocation in a patient with acute promyelocytic leukemia [case report]
22498738 HK3 is: (1) directly activated by PU.1, (2) repressed by PML-RARA, and (3) functionally involved in neutrophil differentiation and cell viability of acute promyelocytic leukemia cells.
22182411 These findings suggest that TRIM32 functions as one of the coactivators for RARalpha-mediated transcription in acute promyelogenous leukemia cells.
22181564 APL lacking an RARalpha rearrangement may possess an alternative mechanism mediating the differentiation block that causes APL.
22056876 a novel paradigm in which a fraction of the cellular RARalpha pool is present in membrane lipid rafts, where it forms complexes with G protein alpha Q (Galphaq) in response to RA
22045737 Coregulator exchange and chromatin binding affect retinoic acid receptor mobility.
22022577 The present study further demonstrated that GRP75 translocates into the nucleus and physically interacts with retinoid receptors (RARalpha and RXRalpha) to augment retinoic acid-elicited neuronal differentiation.
21949683 Data show that TEL as a transcriptional repressor of Retinoic acid receptor (RAR) signaling by its direct binding to both RAR and its dimerisation partner, the retinoid x receptor (RXR) in a ligand-independent fashion.
21934296 investigation of DNA breakpoints in PML-RARalpha V-form fusion transcripts in 7 Chinese acute promyelocytic leukemia patients (out of total of 134 APL patients); in 5 of these cases, the V-form transcripts were unique (i.e., not described previously)
21923909 HIV-1 MA upregulates RARA gene expression in HepG2 cells
21803845 PMLRARalpha binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21736617 Data show that RORalpha is mainly located in human Jurkat T-cell nucleus, and it is co-immunoprecipitated with melatonin.
21613260 Data indicate that PML-RARA (PR)-WT in the soluble fraction was transferred to the insoluble fraction after treatment with AsO, but PR-B/L-mut was stably detected in fractions both with and without AsO.
21451111 both CD1d and CD1c are upregulated by RARalpha signaling in human B cells
21364283 physiologic PML-RARA expression was sufficient to direct a hematopoietic progenitor self-renewal program in vitro and in vivo
21310922 Depletion of S100A10 by RNA interference effectively blocked the enhanced fibrinolytic activity observed after induction of the PML-RAR-alpha oncoprotein
21272161 data indicate that JNK activation by oxidative stress suppresses retinoid signaling through proteasomal degradation of RARalpha
21262770 G-CSF restores RARalpha recruitment to target gene promoters through the activation of the extracellular signal-regulated kinase (ERK)/mitogen-activated protein kinase (MAPK) pathway and the subsequent derepression of chromatin.
21255834 Phenotype onset is correlated with NuMA-RARalpha copy number; mice with higher copy number developing disease later than those with lower copy number.
21254357 One variant in the RARA gene (rs12051734), three variants in the RARB gene (rs6799734, rs12630816, rs17016462), and one variant in the RARG gene (rs3741434) were found to be statistically significant at p < 0.05 as risk factors for meningomyelocele.
21245861 New insights that arose from these studies, in particular focussing on newly identified PML-RARalpha target genes, its interplay with RXR and deregulation of epigenetic modifications.
21190992 Rara haploinsufficiency (like Pml haploinsufficiency and RARA-PML) can cooperate with PML-RARA to influence the pathogenesis of APL in mice, but that PML-RARA is the t(15;17) disease-initiating mutation.
21187718 Autophagy regulates myeloid cell differentiation by p62/SQSTM1-mediated degradation of PML-RARalpha oncoprotein
21150871 RARa-mediated signaling acts as an endogenous protective pathway to slow the progression of kidney disease, and selective activation of the RARa receptor may be a promising treatment option for patients with HIV-associated nephropathy.
21053424 Tribles homolog 1 (Trib1) functions as a negative regulator of Retinoic acid receptor-alpha.
20807888 BCOR is a fusion partner of RARA in a t(X;17)(p11;q12) variant of acute promyelocytic leukemia. BCOR-RARA possesses common features with other RARA fusion proteins.
20804918 RARA amplification in hematologic malignancies may serve as an independent prognostic factor.
20736163 CART1 might be a cytoplasmic, testis-specific derepressor of RAR
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574048 autophagic degradation contributes significantly both to the basal turnover as well as the therapy-induced proteolysis of PML/RARA
20572854 Observational study of gene-disease association. (HuGE Navigator)
20544846 RARA breakpoints are associated with acute promyelocytic leukemia.
20543827 The basal repressive activity of RAR is conferred by an extended beta-strand that forms an antiparallel beta-sheet with specific corepressor residues.
20354914 RAR, RXR and VDR are expressed in human fetal pancreatic progenitor cells.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20190807 Retinoic acid-suppressed phosphorylation of RARalpha induces FGF8f expression to mediate differentiation response pathway in U2OS osteosarcoma cells.
20185965 Role of RARA in differentiation of human mesenchymal stem cells is reported.
20159610 Selective targeting of PU.1-regulated genes by PML/RARalpha is a critical mechanism for the pathogenesis of acute promyelocytic leukemia(APL).
20159609 PML-RARalpha/RXR functions as a local chromatin modulator and that specific recruitment of histone deacetylase activities to genes important for hematopoietic differentiation, RAR signaling, and epigenetic control is crucial to its transforming potential.
20155840 We studied 21 PML-RARA positive/RARA-PML negative cases by bubble PCR and multiplex long template PCR to identify the genomic breakpoints.
20133705 PML/RARalpha transactivates the TF promoter through an indirect interaction with an element composed of a GAGC motif and the flanking nucleotides, independent of AP-1 binding.
20080953 RAR alpha as an essential component of the estrogen receptor-alpha (ER)- complex, potentially by maintaining ER-cofactor interactions, and suggest that different nuclear receptors can cooperate for effective transcriptional activity in breast cancer cells
19965660 Leukemic transformation by acute promyelocytic leuckemia fusion protein PRKAR1A-RARalpha is critically dependent on RXRalpha.
19937600 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19884280 Retinoic acid receptor alpha is the major isoform responsible for CYP26A1 induction.
19863682 alternative splicing of PML/RARalpha transcripts might be involved in nonsense-mediated decay
19855079 Data show that PLZF-RARalpha binds to a region of the c-MYC promoter, suggesting that PLZF-RARalpha may act as a dominant-negative version of PLZF by affecting the regulation of shared targets.
19828696 Data show that induction of CCL2 and CCL24 was directly mediated by ligand-activated retinoic acid receptors.
19799861 redox regulation function of thioredoxin glutathione reductase protects the DNA-binding activity of RAR against cellular ROS damage.
19732752 TNIP1 interacts with liganded RARalpha and RARgamma but acts as a corepressor of their activity.
19628791 Induction of transglutaminase 2 by a liver X receptor/retinoic acid receptor alpha pathway increases the clearance of apoptotic cells by human macrophages.
19626135 Variations in the nucleotide sequence of RARA are not associated with myopia, hypermetropia, or ocular biometric measures.
19626135 Observational study of gene-disease association. (HuGE Navigator)
19563758 Study found that RARalpha/RARgamma exhibit extensive colocalization of their genomic binding regions with ERalpha in the vicinity of genes that are antagonistically regulated by estrogen and RA.
19465599 RARalpha-deficient germ-cell stem cells were able to repopulate germ-cell-depleted wild-type testes and initiate spermatogenesis; however, improper cellular associations and abnormal sperm formation were observed.
19458357 Knockdown of RARalpha2 but not RARalpha1 induced significant MM cell death and growth inhibition; and overexpressing RARalpha2 activated STAT3 and MEK and ERK signaling pathways.
19341714 Ski can stabilize RARalpha and HDAC3 thus Ski represses retinoic acid signaling by stabilizing corepressor complex.
19322209 Knock-in human PML-RARalpha alone can confer properties of self-renewal to committed murine hematopoietic progenitors before the onset of disease.
19224461 Identification of PML/RARalpha fusion gene transcripts that showed no t(15;17) with conventional karyotyping and fluorescent in situ hybridization
19173001 Derangement/lack of a critical factor necessary for RARalpha function induces epigenetic repression of a RA-regulated gene network downstream of RARalpha, with major pleiotropic biological outcomes.
19144697 Data show that retinoids induce gene expression of ADAM10 and alpha-secretase activity by nonpermissive retinoid acid receptor/retinoid X receptor (RAR/RXR) heterodimers, whereby alpha- and beta-isotypes of RAR play a major role.
19128831 First documented case of acute promyelocytic leukemia with an RARalpha submicroscopic deletion which is not associated with X-RARalpha fusion.
19106195 These data indicate that the RAR/RXR heterodimer is a critical regulator of human hematopoietic stem cell (HSC) differentiation, and pharmacological modulation of RXR signaling prevents the loss of human HSCs that otherwise occurs in short-term culture.
19100514 Acute promyelocytic leukemia with insertion of PML exon 7 a and partial deletion of exon 3 of RARA is reported.
19029980 whereas transcriptional activation of PML-RARA is likely to control differentiation, its catabolism triggers leukemia-initiating cell eradication and long-term remission of mouse acute promyelocytic leukemia
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18636556 PML/RARalpha fusion protein mediates the unique sensitivity to arsenic cytotoxicity in acute promyelocytic leukemia cells.
18416830 a role for RAR-alpha engagement in the regulation of genes and proteins involved with human T cell activation and type 2 cytokine production
18305945 IN COLONIC SERRATED ADENOMAS Three genes (TNFRSF10A, BENE, RARA) with strongly significant expression intensities in the oligonucleotide microarray
18212063 Topoisomerase II beta associates with & negatively modulates RARalpha transcriptional activity. Increased levels of and association with TopoIIbeta cause resistance to retinoic acid in acute promyelocytic leukemia cell lines.
18180299 CCR4 plays a role in the regulation of certain endogenous RARalpha target genes and RCD1 and CCR4 might mediate their function through their interaction with NIF-1
18024792 The transcription factor PML-RARalpha regulates key cancer-related genes and pathways by inducing a repressed chromatin formation on its direct genomic target genes.
18000064 supports an active role for PLZF and RARalpha-PLZF in leukemogenesis, identifies up-regulation of CRABPI
17993618 Mechanisms responsible for deregulation of gene expression in acute myeloid leukemia support the notion that diminished RARA expression contributes to leukemogenesis.
17991421 These results would shed new insights for the molecular mechanisms of PML-RARalpha-associated leukemogenesis.
17960617 Promoter hypermethylation of RAR alpha is associated with prostate cancer progression
17943164 PML/RAR gene cytogenetic abnormalities in APL
17761950 demonstrate the distinct regulatory mechanisms of p300 and TR3 on RXRalpha acetylation
17656367 p21WAF1/CIP1 is a common transcriptional target of retinoid receptors RAR and RXR
17628022 Retinoic-acid-induced RAR-CAK signaling events appear to proceed intrinsically during granulocytic development of normal primitive hematopoietic cells. ALDH-governed RA availability may mediate this process by initiating RAR-CAK signaling.
17611697 Am-80-induced cell-type non-specific growth inhibition is mediated by TGF-beta2, where the total mass of RARalpha could be an important regulatory factor in hematologic malignant cells
17595318 Ligand binding to RAR would play a major role in the assembly and intracellular location of a signaling complex involving RAR and the subunits of PI3K.
17475621 the hormone-independent association between PML-RARalpha and coactivators contributes to its ability to regulate gene expression
17456381 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17451432 RARalpha/RXRalpha heterodimer is involved in the differential regulation of the GnRH II gene in neuronal and placental cells
17272867 Observational study of gene-disease association. (HuGE Navigator)
17272513 our results indicate that activator Sp1 and repressor RXRalpha:RARalpha act in concert to regulate MRP3 expression.
17252005 Selection of the RARalpha locus in leukemia patients occursas the consequence of the nuclear architecture of the different RAR loci.
17244680 AML1/ETO participates in a protein complex with the RA receptor alpha (RARalpha) at RA regulatory regions on RARbeta2.
17005281 liganded RXRalpha is a potent activator of endogenous SOX3 protein expression
16797070 The PML-RARA fusions can be identified by molecular analyses such as reverse transcriptase-polymerase chain reaction (PCR) and fluorescence in situ hybridization (FISH).
16769902 providing an explanation for how cAMP synergizes with retinoic acid for transcription
16728697 prevalence of anti-RARalpha antibodies in patients with acute promyelocytic leukemia
16630218 frequencies of the PML-RARalpha transcripts and subtypes in a series of 32 APL patients from Northeast Brazil
16606617 ASXL1 is a novel coactivator of RAR that cooperates with SRC-1
16540467 analysis of cytoplasmic function of mutant promyelocytic leukemia (PML) and PML-retinoic acid receptor-alpha
16504291 The NPM-RAR localizes diffusely throughout the nucleoplasm. NPM-RAR does not alter the localization of PML in transfected HeLa cells, and does not associate with PML in vitro.
16480812 The aryl hydrocarbon receptor activates the retinoic acid receptoralpha through SMRT antagonism
16449642 permanent transcriptional silencing is mediated by the association of PML-RAR with chromatin-modifying enzymes and by recruitment of the histone methyltransferase SUV39H1, responsible for trimethylation of lysine 9 of histone H3
16432238 PML-RARalpha functions by recruiting an HDAC3-MBD1 complex that contributes to the establishment and maintenance of the silenced chromatin state
16424870 Ski seems to be involved in the blocking of differentiation in AML via inhibition of RARalpha signaling
16417524 protein kinase b interacts with RARalpha and phosphorylates the Ser96 residue of its DNA-binding domain.
16311697 Observational study of gene-disease association. (HuGE Navigator)
16289102 All trans retinoic acid suppresses 24-hydroxylase expression through RARalpha-dependent signaling pathway and can enhance vitamin D action in suppression of cell growth.
16239915 RARA is the first myeloid-specific transcription factor shown to be dysregulated by both translocation and aberrant methylation
16203797 p16INK4a, RARbeta, and MGMT expression is activated by genistein and related soy isoflavones partially through a direct inhibition of DNA methyltransferase
16113082 loss of one copy of PU.1 through deletion, plus down-regulation of the residual allele caused by PML-RARalpha expression, synergizes to expand myeloid progenitors susceptible to transformation, increasing the penetrance of acute promyelocytic leukemia
16085646 all-trans-retinoic acid, an RARalpha ligand, regulates IFNgamma-induced IRF-1 by affecting multiple components of the IFNgamma signaling pathway, from the plasma membrane to the nuclear transcription factors
15870697 Transient transfection of either all-trans-retinoic acid (ATRA) receptor alpha or estrogen receptor alpha expression vectors increased cellular retinoic acid binding protein II expression in MDA-MB-231 cells
15831516 analysis of estrogen activation of the retinoic acid receptor alpha1 gene in breast cancer cells
15809060 inhibition of monocyte differentiation all contribute to the oncogenic activity of PML-RARalpha
15746941 CDDO-Im downregulates RARA expression in acute promyelocytic leukemic cells.
15635645 Observational study of gene-disease association. (HuGE Navigator)
15601827 PML-retinoic acid receptor alpha activities are regulated by neutrophil elastase in early myeloid cells
15337793 retinoic acid receptor-alpha is synthesized by activated polymorphonuclear leukocytes
15255287 Increase in expression of RARalpha is associated with esophageal squamous cell carcinomas
15246741 intrinsic ageing of human skin is accompanied by significant elevation in the content of RAR alpha
15171703 Results show an increased DNA binding of the retinoic acid receptor alpha/retinoid X receptor alpha heterodimer and the stability of nuclear localization of this heterodimer, which facilitates signal transduction.
14737102 role in development of myelodi leukemia with promyelocytic features
14705796 depletion of vitamin A and retinoid receptors by UV irradiation, together with unchanged or even increased c-Jun levels, might seriously interfere with retinoid signaling and thus promote future tumor development, especially in keratinocytes.
14691372 In a 9-cis retinoic acid-dependent fashion in cells in vitro, retinoic acid receptor alpha isoform stimulates the expression of reporter constructs containing the site that binds aldehyde dehydrogenase-2.
14592536 RARA has a distinct role and functional mode in mediating tretinoin-induced signalling.
14559998 data suggest that Sp110b is a transcriptional cofactor negatively regulating retinoic acid receptor alpha-mediated transcription
12935958 REVIEW the biology of RARalpha, and the RARalpha fusion proteins created in APL and the normal forms of the partner proteins
12835288 Observational study of gene-disease association. (HuGE Navigator)
12810556 endocrine molecule retinoic acid, and its receptor RARs play a critical role in alveolarization during the neonatal period of the lung.
12505266 Cryptic translocation of PML/RARA on 17q. A rare event in acute promyelocytic leukemia.
12468549 mutational analysis of human retinoic acid receptor alpha ligand binding domain
12420222 RAR pan-agonists and the RARalpha-selective agonist Am580, but not RXR agonists, stimulate the expression of SOX9 in a wide variety of retinoid-inhibited breast cancer cell lines.
12399530 In normal epithelium, both RAR-alpha and -gamma present with minimal nuclear accumulation. Increased in luminal epithelial nuclei in prostatic intra-epithelial neoplasia
12393611 IL-3-induced enhancement of retinoic acid receptor activity is mediated through Stat5, which physically associates with recombinant human retinoic acid receptors in an IL-3-dependent manner.
12213824 Retinoid-induced G1 arrest and differentiation activation are associated with a switch to cyclin-dependent kinase-activating kinase hypophosphorylation of the receptor.
12193472 the silencing of the RAR alpha2 promoter by hypermethylation may play a contributory role in the dysregulation of RA signaling in mammary tumorigenesis.
12080444 obesity is associated with an inverse relationship between peroxisome proliferator-activated receptor gamma and RARalpha expressions in subcutaneous adipose tissue
12060771 induces acute promyelocytic leukemia in a mouse model
12009305 Results show that both RARalpha and RARbeta are mediators in the anticancer function of All-trans retinoic acid via AP-1 activity inhibition.
11929748 Interactions of STAT5b-RARalpha, a novel acute promyelocytic leukemia fusion protein, with retinoic acid receptor and STAT3 signaling pathways.
11891284 UBE1L is a retinoid target that triggers PML/RARalpha degradation and apoptosis in acute promyelocytic leukemia
11106752 two critical hits for promyelocytic leukemia

AA Sequence

MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEE      1 - 70
IVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRC     71 - 140
QYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTT    141 - 210
NNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPE    211 - 280
QDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDM    281 - 350
LQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL    351 - 420
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP                                421 - 462
//

Text Mined References (294)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
26969398 2016 Regulation of vitamin D receptor expression by retinoic acid receptor alpha in acute myeloid leukemia cells.
26728137 2016 All-trans retinoic acid synergizes with topotecan to suppress AML cells via promoting RAR?-mediated DNA damage.
26537301 2016 Varying responses of PML-RARA with different genetic mutations to arsenic trioxide.
26294332 2015 Evaluating frequency of PML-RARA mutations and conferring resistance to arsenic trioxide-based therapy in relapsed acute promyelocytic leukemia patients.
26213848 2015 Methylated arsenic metabolites bind to PML protein but do not induce cellular differentiation and PML-RAR? protein degradation.
26088929 2015 Transcription and methylation analyses of preleukemic promyelocytes indicate a dual role for PML/RARA in leukemia initiation.
26041820 2015 PML/RAR?-Regulated miR-181a/b Cluster Targets the Tumor Suppressor RASSF1A in Acute Promyelocytic Leukemia.
26026090 2015 Bortezomib Causes ER Stress-related Death of Acute Promyelocytic Leukemia Cells Through Excessive Accumulation of PML-RARA.
25791120 2015 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NF?B and JNK.
25680531 2015 MicroRNA-138 promotes tau phosphorylation by targeting retinoic acid receptor alpha.
25550158 2015 Dysregulation of retinoic acid receptor diminishes hepatocyte permissiveness to hepatitis B virus infection through modulation of sodium taurocholate cotransporting polypeptide (NTCP) expression.
25416956 2014 A proteome-scale map of the human interactome network.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25300573 2015 Enhanced expression of retinoic acid receptor alpha (RARA) induces epithelial-to-mesenchymal transition and disruption of mammary acinar structures.
25275592 2014 Transcriptional repression of CDKN2D by PML/RAR? contributes to the altered proliferation and differentiation block of acute promyelocytic leukemia cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25071154 2014 Role of UTX in retinoic acid receptor-mediated gene regulation in leukemia.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25033841 2014 Extrinsic apoptosis is impeded by direct binding of the APL fusion protein NPM-RAR to TRADD.
24992177 Expression and Subcellular Localization of Retinoic Acid Receptor-? (RAR?) in Healthy and Varicocele Human Spermatozoa: Its Possible Regulatory Role in Capacitation and Survival.
24819975 2014 Small ubiquitin-related modifier-1 modification regulates all-trans-retinoic acid-induced differentiation via stabilization of retinoic acid receptor ?.
24806185 2014 Resistance to arsenic therapy in acute promyelocytic leukemia.
24711541 2014 HIF factors cooperate with PML-RAR? to promote acute promyelocytic leukemia progression and relapse.
24608861 2014 E2F1 impairs all-trans retinoic acid-induced osteogenic differentiation of osteosarcoma via promoting ubiquitination-mediated degradation of RAR?.
24516348 2014 NLS-RAR? promotes proliferation and inhibits differentiation in HL-60 cells.
24394593 2014 A TDG/CBP/RAR? ternary complex mediates the retinoic acid-dependent expression of DNA methylation-sensitive genes.
24264050 2014 A novel RAR?/CAR-mediated mechanism for regulation of human organic solute transporter-? gene expression.
24183235 2013 Interaction with RXR is necessary for NPM-RAR-induced myeloid differentiation blockade.
24050824 2013 Association of peroxisome proliferator-activated receptors/retinoic acid receptors with renal diseases.
24038216 2014 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBP? during granulocytic differentiation but repressed by PML-RAR? in APL.
23969901 2013 mRNA expression pattern of retinoic acid and retinoid X nuclear receptor subtypes in human thyroid papillary carcinoma.
23927396 2014 NPM-RAR, not the RAR-NPM reciprocal t(5;17)(q35;q21) acute promyelocytic leukemia fusion protein, inhibits myeloid differentiation.
23898169 2013 RAR?-PLZF oncogene inhibits C/EBP? function in myeloid cells.
23868472 2013 Retinoic acid receptor alpha is associated with tamoxifen resistance in breast cancer.
23847194 2013 RAR?2 expression confers myeloma stem cell features.
23782583 2013 The effect of genetic polymorphisms of RARA gene on the adverse effects profile of isotretinoin-treated acne patients.
23775127 2013 The corepressor CTBP2 is a coactivator of retinoic acid receptor/retinoid X receptor in retinoic acid signaling.
23770850 2014 Coordinated regulation of the immunoproteasome subunits by PML/RAR? and PU.1 in acute promyelocytic leukemia.
23612809 2013 [Molecular subtypes of PML/RAR? in patients with acute promyelocytic leukemia].
23518351 2013 The histone demethylase PHF8 governs retinoic acid response in acute promyelocytic leukemia.
23474897 2013 Practical synthesis of a chromene analog for use as a retinoic acid receptor alpha antagonist lead compound.
23448850 2013 The limited contribution of DNA methylation to PML-RAR? induced leukemia.
23271512 2013 All-trans retinoic acid and arsenic trioxide resistance of acute promyelocytic leukemia with the variant STAT5B-RARA fusion gene.
23102699 2012 Poly (ADP-ribose) glycohydrolase regulates retinoic acid receptor-mediated gene expression.
23064710 2013 Sequence-specific electrochemical detection of double-strand PCR amplicons of PML/RAR? fusion gene in acute promyelocytic leukemia.
23064648 2012 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
22982005 2012 Microarray, gene sequencing, and reverse transcriptase-polymerase chain reaction analyses of a cryptic PML-RARA translocation.
22498738 2012 PU.1 is linking the glycolytic enzyme HK3 in neutrophil differentiation and survival of APL cells.
22351778 2012 Familial focal segmental glomerulosclerosis (FSGS)-linked ?-actinin 4 (ACTN4) protein mutants lose ability to activate transcription by nuclear hormone receptors.
22182411 2012 TRIM32 promotes retinoic acid receptor ?-mediated differentiation in human promyelogenous leukemic cell line HL60.
22181564 2011 Infantile acute promyelocytic leukemia without an RAR? rearrangement.
22135230 2012 Retinoid-regulated FGF8f secretion by osteoblasts bypasses retinoid stimuli to mediate granulocytic differentiation of myeloid leukemia cells.
22056876 2012 A retinoic acid receptor RAR? pool present in membrane lipid rafts forms complexes with G protein ?Q to activate p38MAPK.
22045737 2011 Live-cell fluorescence correlation spectroscopy dissects the role of coregulator exchange and chromatin binding in retinoic acid receptor mobility.
22022577 2011 Nuclear GRP75 binds retinoic acid receptors to promote neuronal differentiation of neuroblastoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21949683 2011 The ETS family member TEL binds to nuclear receptors RAR and RXR and represses gene activation.
21934296 2011 The PML gene of the PML-RAR? V-form fusion transcript breaks within exon 6.
21803845 2011 PMLRAR? binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21736617 2011 Melatonin synthesized by T lymphocytes as a ligand of the retinoic acid-related orphan receptor.
21613260 2011 Missense mutations in PML-RARA are critical for the lack of responsiveness to arsenic trioxide treatment.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21451111 2011 CD1d and CD1c expression in human B cells is regulated by activation and retinoic acid receptor signaling.
21364283 2011 PML-RARA can increase hematopoietic self-renewal without causing a myeloproliferative disease in mice.
21310922 2011 Regulation of S100A10 by the PML-RAR-? oncoprotein.
21272161 2011 c-Jun N-terminal kinase activation by oxidative stress suppresses retinoid signaling through proteasomal degradation of retinoic acid receptor ? protein in hepatic cells.
21262770 2011 New role for granulocyte colony-stimulating factor-induced extracellular signal-regulated kinase 1/2 in histone modification and retinoic acid receptor ? recruitment to gene promoters: relevance to acute promyelocytic leukemia cell differentiation.
21255834 2011 Correlation among nuclear localization of NuMA-RAR?, deregulation of gene expression and leukemic phenotype of hCG-NuMA-RAR? transgenic mice.
21254357 2011 Association of retinoic acid receptor genes with meningomyelocele.
21245861 2011 Genome-wide functions of PML-RAR? in acute promyelocytic leukaemia.
21190992 2011 Rara haploinsufficiency modestly influences the phenotype of acute promyelocytic leukemia in mice.
21187718 2011 Autophagy regulates myeloid cell differentiation by p62/SQSTM1-mediated degradation of PML-RAR? oncoprotein.
21150871 2011 Role of the retinoic acid receptor-? in HIV-associated nephropathy.
21053424 2010 Human Tribbles homolog 1 functions as a negative regulator of retinoic acid receptor.
20807888 2010 BCOR as a novel fusion partner of retinoic acid receptor alpha in a t(X;17)(p11;q12) variant of acute promyelocytic leukemia.
20804918 2010 Amplification of the RARA gene in acute myeloid leukemia: significant finding or coincidental observation?
20736163 2010 A novel cytoplasmic adaptor for retinoic acid receptor (RAR) and thyroid receptor functions as a Derepressor of RAR in the absence of retinoic acid.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574048 2010 Autophagy contributes to therapy-induced degradation of the PML/RARA oncoprotein.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20544846 2010 Analysis of t(15;17) chromosomal breakpoint sequences in therapy-related versus de novo acute promyelocytic leukemia: association of DNA breaks with specific DNA motifs at PML and RARA loci.
20543827 2010 A unique secondary-structure switch controls constitutive gene repression by retinoic acid receptor.
20413580 2010 Human ADA3 regulates RARalpha transcriptional activity through direct contact between LxxLL motifs and the receptor coactivator pocket.
20354914 2011 Vitamin D and vitamin A receptor expression and the proliferative effects of ligand activation of these receptors on the development of pancreatic progenitor cells derived from human fetal pancreas.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20215566 2010 Activity of retinoic acid receptor-alpha is directly regulated at its protein kinase A sites in response to follicle-stimulating hormone signaling.
20190807 2010 Retinoid-suppressed phosphorylation of RARalpha mediates the differentiation pathway of osteosarcoma cells.
20185965 2010 Role of retinoic acid-related orphan receptor-alpha in differentiation of human mesenchymal stem cells along with osteoblastic lineage.
20159610 2010 PML/RARalpha targets promoter regions containing PU.1 consensus and RARE half sites in acute promyelocytic leukemia.
20159609 2010 PML-RARalpha/RXR Alters the Epigenetic Landscape in Acute Promyelocytic Leukemia.
20155840 2010 Atypical mRNA fusions in PML-RARA positive, RARA-PML negative acute promyelocytic leukemia.
20133705 2010 PML/RARalpha fusion protein transactivates the tissue factor promoter through a GAGC-containing element without direct DNA association.
20080953 2010 Cooperative interaction between retinoic acid receptor-alpha and estrogen receptor in breast cancer.
19965660 2010 Leukemic transformation by the APL fusion protein PRKAR1A-RAR{alpha} critically depends on recruitment of RXR{alpha}.
19937600 2010 Testing reported associations of genetic risk factors for oral clefts in a large Irish study population.
19934264 2010 Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells.
19917671 2010 Loss of CAK phosphorylation of RAR{alpha} mediates transcriptional control of retinoid-induced cancer cell differentiation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19884280 2010 A comparison of the roles of peroxisome proliferator-activated receptor and retinoic acid receptor on CYP26 regulation.
19863682 2010 Expression patterns of specific promyelocytic/retinoic acid receptor-alpha transcripts in patients with acute promyelocytic leukemia.
19855079 2009 Comprehensive genomic screens identify a role for PLZF-RARalpha as a positive regulator of cell proliferation via direct regulation of c-MYC.
19850744 2009 Small ubiquitin-like modifier-2 modification of retinoic acid receptor-alpha regulates its subcellular localization and transcriptional activity.
19828696 2009 Chemokine induction by all-trans retinoic acid and arsenic trioxide in acute promyelocytic leukemia: triggering the differentiation syndrome.
19799861 2009 Redox regulation of transcriptional activity of retinoic acid receptor by thioredoxin glutathione reductase (TGR).
19732752 2009 Liganded RARalpha and RARgamma interact with but are repressed by TNIP1.
19628791 2009 Induction of transglutaminase 2 by a liver X receptor/retinoic acid receptor alpha pathway increases the clearance of apoptotic cells by human macrophages.
19626135 2009 The retinoic acid receptor alpha (RARA) gene is not associated with myopia, hypermetropia, and ocular biometric measures.
19563758 2009 Genomic antagonism between retinoic acid and estrogen signaling in breast cancer.
19465599 2009 Expression of retinoic acid receptor alpha in the germline is essential for proper cellular association and spermiogenesis during spermatogenesis.
19458357 2009 RARalpha2 expression is associated with disease progression and plays a crucial role in efficacy of ATRA treatment in myeloma.
19377461 2009 GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.
19345331 2009 ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome.
19341714 2009 The Ski protein can inhibit ligand induced RARalpha and HDAC3 degradation in the retinoic acid signaling pathway.
19322209 2009 PML-RARalpha initiates leukemia by conferring properties of self-renewal to committed promyelocytic progenitors.
19224461 2009 Identification of PML/RARalpha fusion gene transcripts that showed no t(15;17) with conventional karyotyping and fluorescent in situ hybridization.
19173001 2009 Derangement of a factor upstream of RARalpha triggers the repression of a pleiotropic epigenetic network.
19144697 2009 Up-regulation of the alpha-secretase ADAM10 by retinoic acid receptors and acitretin.
19128831 2009 Y-chromosome loss as the sole karyotypic anomaly with 3'RARalpha submicroscopic deletion in a case of M3r subtype of acute promyelocytic leukemia.
19106195 2009 Pharmacological manipulation of the RAR/RXR signaling pathway maintains the repopulating capacity of hematopoietic stem cells in culture.
19100514 2009 Acute promyelocytic leukemia with insertion of PML exon 7a and partial deletion of exon 3 of RARA: a novel variant transcript related to aggressive course and not detected with real-time polymerase chain reaction analysis.
19029980 2008 Eradication of acute promyelocytic leukemia-initiating cells through PML-RARA degradation.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18922886 2008 Retinoic acid-dependent activation of the polycystic kidney disease-1 (PKD1) promoter.
18845237 2009 Retinoic acid regulates the human methionine sulfoxide reductase A (MSRA) gene via two distinct promoters.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18636556 2008 PML/RARalpha fusion protein mediates the unique sensitivity to arsenic cytotoxicity in acute promyelocytic leukemia cells: Mechanisms involve the impairment of cAMP signaling and the aberrant regulation of NADPH oxidase.
18416830 2008 The Retinoic Acid Receptor-alpha mediates human T-cell activation and Th2 cytokine and chemokine production.
18305945 2008 Gene profiling of colonic serrated adenomas by using oligonucleotide microarray.
18212063 2008 Topoisomerase IIbeta negatively modulates retinoic acid receptor alpha function: a novel mechanism of retinoic acid resistance.
18180299 2008 Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1.
18024792 2008 Chromatin modifications induced by PML-RARalpha repress critical targets in leukemogenesis as analyzed by ChIP-Chip.
18000064 2007 RARalpha-PLZF overcomes PLZF-mediated repression of CRABPI, contributing to retinoid resistance in t(11;17) acute promyelocytic leukemia.
17993618 2008 DNA methylation-independent loss of RARA gene expression in acute myeloid leukemia.
17991421 2008 Coiled-coil domain of PML is essential for the aberrant dynamics of PML-RARalpha, resulting in sequestration and decreased mobility of SMRT.
17960617 2008 Promoter hypermethylation in circulating blood cells identifies prostate cancer progression.
17943164 2008 The genetic characterization of acute promyelocytic leukemia with cryptic t(15;17) including a new recurrent additional cytogenetic abnormality i(17)(q10).
17761950 2007 Orphan receptor TR3 attenuates the p300-induced acetylation of retinoid X receptor-alpha.
17712046 2007 The PRKAR1A gene is fused to RARA in a new variant acute promyelocytic leukemia.
17656367 2007 p21WAF1/CIP1 is a common transcriptional target of retinoid receptors: pleiotropic regulatory mechanism through retinoic acid receptor (RAR)/retinoid X receptor (RXR) heterodimer and RXR/RXR homodimer.
17641689 2007 MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation.
17628022 2007 Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
17611697 2007 RARalpha is a regulatory factor for Am-80-induced cell growth inhibition of hematologic malignant cells.
17595318 2007 Rapid, nongenomic actions of retinoic acid on phosphatidylinositol-3-kinase signaling pathway mediated by the retinoic acid receptor.
17560333 2007 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia.
17538076 2007 Regulation of 17-beta hydroxysteroid dehydrogenase type 2 in human placental endothelial cells.
17475621 2007 Aberrant association of promyelocytic leukemia protein-retinoic acid receptor-alpha with coactivators contributes to its ability to regulate gene expression.
17468032 2007 Acute promyelocytic leukemia: new issues on pathogenesis and treatment response.
17456381 2007 [Association between retinoic acid receptor alpha gene polymorphisms and nonsyndromic cleft lip with or without cleft palate susceptibility].
17455211 2007 RIF-1, a novel nuclear receptor corepressor that associates with the nuclear matrix.
17451432 2007 Involvement of NF-kappaB subunit p65 and retinoic acid receptors, RARalpha and RXRalpha, in transcriptional regulation of the human GnRH II gene.
17363140 2007 The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor.
17272867 2007 Few associations of candidate genes with nonsyndromic orofacial clefts in the population of Lithuania.
17272513 2007 Nuclear receptors RXRalpha:RARalpha are repressors for human MRP3 expression.
17252005 2007 A redundant oncogenic potential of the retinoic receptor (RAR) alpha, beta and gamma isoforms in acute promyelocytic leukemia.
17244680 2007 Heterochromatic gene repression of the retinoic acid pathway in acute myeloid leukemia.
17195188 2007 Comparison of the expression patterns of newly identified zebrafish retinoic acid and retinoid X receptors.
17005281 2006 Mapping of the RXRalpha binding elements involved in retinoic acid induced transcriptional activation of the human SOX3 gene.
16797070 2007 Identification of PML-RARA rearrangement by RT-PCR and sequencing in an acute promyelocytic leukemia without t(15;17) on G-banding and FISH.
16769902 2006 Phosphorylation by PKA potentiates retinoic acid receptor alpha activity by means of increasing interaction with and phosphorylation by cyclin H/cdk7.
16728697 2006 Frequent antibody production against RARalpha in both APL mice and patients.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16630218 2006 PML-RARalpha fusion gene transcripts and biological features in acute promyelocytic leukemia patients.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16606617 2006 Additional sex comb-like 1 (ASXL1), in cooperation with SRC-1, acts as a ligand-dependent coactivator for retinoic acid receptor.
16540467 2006 Cytoplasmic function of mutant promyelocytic leukemia (PML) and PML-retinoic acid receptor-alpha.
16504291 2006 The NPM-RAR fusion protein associated with the t(5;17) variant of APL does not interact with PML.
16480812 The aryl hydrocarbon receptor activates the retinoic acid receptoralpha through SMRT antagonism.
16456540 2006 P38MAPK-dependent phosphorylation and degradation of SRC-3/AIB1 and RARalpha-mediated transcription.
16449642 2006 Recruitment of the histone methyltransferase SUV39H1 and its role in the oncogenic properties of the leukemia-associated PML-retinoic acid receptor fusion protein.
16432238 2006 The methyl-CpG binding protein MBD1 is required for PML-RARalpha function.
16424870 2006 Inhibition of retinoic acid receptor signaling by Ski in acute myeloid leukemia.
16417524 2006 Akt phosphorylates and suppresses the transactivation of retinoic acid receptor alpha.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16311697 2005 [Possible association due to linkage disequilibrium of TGFA, RARA and BCL3 with nonsyndromic cleft lip with or without cleft palate in the Chilean population].
16289102 2005 Retinoic acid via RARalpha inhibits the expression of 24-hydroxylase in human prostate stromal cells.
16239915 2005 Aberrant promoter methylation of the retinoic acid receptor alpha gene in acute promyelocytic leukemia.
16203797 2005 Reversal of hypermethylation and reactivation of p16INK4a, RARbeta, and MGMT genes by genistein and other isoflavones from soy.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16179254 2005 The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling.
16113082 2005 Reduced PU.1 expression causes myeloid progenitor expansion and increased leukemia penetrance in mice expressing PML-RARalpha.
16085646 2005 Physiological and receptor-selective retinoids modulate interferon gamma signaling by increasing the expression, nuclear localization, and functional activity of interferon regulatory factor-1.
15870697 2005 Expression of estrogen receptor alpha, retinoic acid receptor alpha and cellular retinoic acid binding protein II genes is coordinately regulated in human breast cancer cells.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15831516 2005 Functional genomics identifies a mechanism for estrogen activation of the retinoic acid receptor alpha1 gene in breast cancer cells.
15809060 2005 Requirement of the coiled-coil domain of PML-RARalpha oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation.
15808511 2005 PARP-1 determines specificity in a retinoid signaling pathway via direct modulation of mediator.
15746941 2005 Triterpenoid CDDO-Im downregulates PML/RARalpha expression in acute promyelocytic leukemia cells.
15674337 2005 Coactivation of nuclear receptors and myogenic factors induces the major BTG1 influence on muscle differentiation.
15635645 2005 Structural variants in the retinoid receptor genes in patients with schizophrenia and other psychiatric diseases.
15601827 2005 Neutrophil elastase is important for PML-retinoic acid receptor alpha activities in early myeloid cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337793 2004 Activated polymorphonuclear leukocytes rapidly synthesize retinoic acid receptor-alpha: a mechanism for translational control of transcriptional events.
15255287 2004 Differential expression of retinoic acid receptors in normal and malignant esophageal tissues.
15249124 2004 hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor.
15246741 2004 Retinoic acid receptor alpha expression and cutaneous ageing.
15171703 2004 Ubiquitinated or sumoylated retinoic acid receptor alpha determines its characteristic and interacting model with retinoid X receptor alpha in gastric and breast cancer cells.
14737102 2004 Myeloid leukemia with promyelocytic features in transgenic mice expressing hCG-NuMA-RARalpha.
14705796 2003 Differential effects of UV irradiation on nuclear retinoid receptor levels in cultured keratinocytes and melanocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691372 2003 Identification of a retinoid receptor response element in the human aldehyde dehydrogenase-2 promoter.
14592536 2004 Distinct role and functional mode of TR3 and RARalpha in mediating ATRA-induced signalling pathway in breast and gastric cancer cells.
14559998 2003 Modulation of retinoid signaling by a cytoplasmic viral protein via sequestration of Sp110b, a potent transcriptional corepressor of retinoic acid receptor, from the nucleus.
14521715 2003 PLZF is a negative regulator of retinoic acid receptor transcriptional activity.
12935958 2003 Molecular pathogenesis of acute promyelocytic leukaemia and APL variants.
12935927 2003 New highly sensitive fluorescence in situ hybridization method to detect PML/RARA fusion in acute promyelocytic leukemia.
12835288 2003 Retinoic acid receptor alpha gene variants, multivitamin use, and liver intake as risk factors for oral clefts: a population-based case-control study in Denmark, 1991-1994.
12810556 2003 Overexpression of dominant negative retinoic acid receptor alpha causes alveolar abnormality in transgenic neonatal lungs.
12691149 2003 Cytogenetics, FISH and RT-PCR analysis of acute promyelocytic leukemia: structure of the fusion point in a case lacking classic t(15;17) translocation.
12549917 2003 Effects of retinoid ligands on RIP140: molecular interaction with retinoid receptors and biological activity.
12505266 2002 Cryptic translocation of PML/RARA on 17q. A rare event in acute promyelocytic leukemia.
12482873 2003 Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468549 2003 Co-repressor release but not ligand binding is a prerequisite for transcription activation by human retinoid acid receptor alpha ligand-binding domain.
12420222 2002 RAR agonists stimulate SOX9 gene expression in breast cancer cell lines: evidence for a role in retinoid-mediated growth inhibition.
12403842 2002 Real-time analysis of molecular interaction of retinoid receptors and receptor-interacting protein 140 (RIP140).
12399530 Immunohistochemical localization of the retinoic Acid receptors in human prostate.
12393611 2002 IL-3-induced enhancement of retinoic acid receptor activity is mediated through Stat5, which physically associates with retinoic acid receptors in an IL-3-dependent manner.
12235159 2002 Human papilloma virus 16 E6 oncoprotein inhibits retinoic X receptor-mediated transactivation by targeting human ADA3 coactivator.
12213824 2002 Retinoid-induced G1 arrest and differentiation activation are associated with a switch to cyclin-dependent kinase-activating kinase hypophosphorylation of retinoic acid receptor alpha.
12193472 2002 Retinoic acid receptor alpha2 is a growth suppressor epigenetically silenced in MCF-7 human breast cancer cells.
12138096 2002 An LXXLL motif in the transactivation domain of STAT6 mediates recruitment of NCoA-1/SRC-1.
12101409 2002 Krüppel-like zinc-finger transcription factor KLF5/BTEB2 is a target for angiotensin II signaling and an essential regulator of cardiovascular remodeling.
12080444 2002 Relationship between peroxisome proliferator-activated receptor gamma and retinoic acid receptor alpha gene expression in obese human adipose tissue.
12060771 2002 PML/RARalpha and FLT3-ITD induce an APL-like disease in a mouse model.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12009305 2002 Anticancer effect of retinoic acid via AP-1 activity repression is mediated by retinoic acid receptor alpha and beta in gastric cancer cells.
12000751 2002 Regulation of retinoic acid receptor alpha by protein kinase C in B16 mouse melanoma cells.
11971969 2002 ERAP140, a conserved tissue-specific nuclear receptor coactivator.
11929748 2002 Interactions of STAT5b-RARalpha, a novel acute promyelocytic leukemia fusion protein, with retinoic acid receptor and STAT3 signaling pathways.
11891284 2002 UBE1L is a retinoid target that triggers PML/RARalpha degradation and apoptosis in acute promyelocytic leukemia.
11812818 2001 Retinoic acid receptor alpha1 variants, RARalpha1DeltaB and RARalpha1DeltaBC, define a new class of nuclear receptor isoforms.
11574675 2001 PNRC2 is a 16 kDa coactivator that interacts with nuclear receptors through an SH3-binding motif.
11439184 2001 Regulation of CLOCK and MOP4 by nuclear hormone receptors in the vasculature: a humoral mechanism to reset a peripheral clock.
11382777 2001 Irx4 forms an inhibitory complex with the vitamin D and retinoic X receptors to regulate cardiac chamber-specific slow MyHC3 expression.
11358960 2001 Retinoblastoma-binding protein 2 (Rbp2) potentiates nuclear hormone receptor-mediated transcription.
11331609 2001 Sharp, an inducible cofactor that integrates nuclear receptor repression and activation.
11274148 2001 Protein-protein interaction of retinoic acid receptor alpha and thyroid transcription factor-1 in respiratory epithelial cells.
11106752 2000 Two critical hits for promyelocytic leukemia.
11014615 2000 Retinoid X receptor mRNA expression in human pituitary gland.
10938104 2000 Potentiation of GATA-2 activity through interactions with the promyelocytic leukemia protein (PML) and the t(15;17)-generated PML-retinoic acid receptor alpha oncoprotein.
10882117 2000 Oligomerization of RAR and AML1 transcription factors as a novel mechanism of oncogenic activation.
10882070 2000 Crystal structure of a heterodimeric complex of RAR and RXR ligand-binding domains.
10872826 2000 Gadd45 family proteins are coactivators of nuclear hormone receptors.
10866662 2000 A new family of nuclear receptor coregulators that integrate nuclear receptor signaling through CREB-binding protein.
10860982 2000 Differential ligand-dependent protein-protein interactions between nuclear receptors and a neuronal-specific cofactor.
10786636 2000 Nuclear receptor binding factor-2 (NRBF-2), a possible gene activator protein interacting with nuclear hormone receptors.
10760302 2000 Ligand-dependent interactions of coactivators steroid receptor coactivator-1 and peroxisome proliferator-activated receptor binding protein with nuclear hormone receptors can be imaged in live cells and are required for transcription.
10698945 2000 Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.
10617585 2000 Retinoic acid stimulation of the human surfactant protein B promoter is thyroid transcription factor 1 site-dependent.
10611353 1999 Retina-specific nuclear receptor: A potential regulator of cellular retinaldehyde-binding protein expressed in retinal pigment epithelium and Müller glial cells.
10567404 1999 A nuclear factor, ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.
10531331 1999 Characterization of receptor-interacting protein 140 in retinoid receptor activities.
10480874 1999 Selective binding of steroid hormone receptors to octamer transcription factors determines transcriptional synergism at the mouse mammary tumor virus promoter.
10454579 1999 Activating signal cointegrator 1, a novel transcription coactivator of nuclear receptors, and its cytosolic localization under conditions of serum deprivation.
10361124 1999 Physical interaction between retinoic acid receptor and Sp1: mechanism for induction of urokinase by retinoic acid.
10337631 1999 Genomic structure of the human retinoic acid receptor-alpha1 gene.
10207062 1999 Alien, a highly conserved protein with characteristics of a corepressor for members of the nuclear hormone receptor superfamily.
10022764 1998 Receptor-interacting protein 140 interacts with and inhibits transactivation by, peroxisome proliferator-activated receptor alpha and liver-X-receptor alpha.
9795230 1998 Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors.
9773978 1998 Inhibition of estrogen receptor action by the orphan receptor SHP (short heterodimer partner).
9717844 1998 Estrogen receptor, a common interaction partner for a subset of nuclear receptors.
9653119 1998 The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion.
9642262 1998 Interaction of BAG-1 with retinoic acid receptor and its inhibition of retinoic acid-induced apoptosis in cancer cells.
9632709 1998 Isolation and characterization of a novel coactivator protein, NCoA-62, involved in vitamin D-mediated transcription.
9628876 1998 Two distinct nuclear receptor interaction domains in NSD1, a novel SET protein that exhibits characteristics of both corepressors and coactivators.
9491782 1998 RAR-, not RXR, ligands inhibit cell activation and prevent apoptosis in B-lymphocytes.
9445475 1998 Transcription factor-specific requirements for coactivators and their acetyltransferase functions.
9288109 1997 Fusion of retinoic acid receptor alpha to NuMA, the nuclear mitotic apparatus protein, by a variant translocation in acute promyelocytic leukaemia.
9267036 1997 Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.
9115274 1997 Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.
9005841 1996 Biosynthesis and function of all-trans- and 9-cis-retinoic acid in parathyroid cells.
8616895 1996 A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors.
8562957 1996 The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.
8302850 1994 PLZF-RAR alpha fusion proteins generated from the variant t(11;17)(q23;q21) translocation in acute promyelocytic leukemia inhibit ligand-dependent transactivation of wild-type retinoic acid receptors.
8244378 1993 High-density genetic map of the BRCA1 region of chromosome 17q12-q21.
8051161 1994 Immunological identification and functional quantitation of retinoic acid and retinoid X receptor proteins in human skin.
7566127 1995 A transcriptional co-repressor that interacts with nuclear hormone receptors.
2899875 1988 A PstI RFLP for the human retinoic acid receptor in 17q21.
2825036 1987 Identification of a receptor for the morphogen retinoic acid.
2825025 1987 A human retinoic acid receptor which belongs to the family of nuclear receptors.
2218500 1990 Molecular analysis of acute promyelocytic leukemia breakpoint cluster region on chromosome 17.
2175878 1990 Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha).
2170850 1990 The t(15;17) translocation of acute promyelocytic leukaemia fuses the retinoic acid receptor alpha gene to a novel transcribed locus.
1652369 1991 The PML-RAR alpha fusion mRNA generated by the t(15;17) translocation in acute promyelocytic leukemia encodes a functionally altered RAR.
1347744 1992 A transferable silencing domain is present in the thyroid hormone receptor, in the v-erbA oncogene product and in the retinoic acid receptor.
1311253 1992 Structure, localization and transcriptional properties of two classes of retinoic acid receptor alpha fusion proteins in acute promyelocytic leukemia (APL): structural similarities with a new family of oncoproteins.
1310351 1992 Retinoid X receptor interacts with nuclear receptors in retinoic acid, thyroid hormone and vitamin D3 signalling.