Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.39
PubTator Score 0.53

Knowledge Summary


No data available


  Differential Expression (20)

Disease log2 FC p
posterior fossa group B ependymoma -2.200 1.9e-14
esophageal adenocarcinoma -1.400 3.6e-02
psoriasis -2.400 3.2e-05
cutaneous lupus erythematosus -1.400 1.7e-02
astrocytoma -1.200 1.9e-21
glioblastoma -1.600 7.7e-11
oligodendroglioma -1.200 2.4e-17
atypical teratoid/rhabdoid tumor -1.300 4.7e-04
medulloblastoma, large-cell -1.300 5.5e-04
primitive neuroectodermal tumor -1.400 3.1e-04
pancreatic ductal adenocarcinoma liver m... 1.116 2.2e-02
non-small cell lung cancer 1.376 2.4e-08
intraductal papillary-mucinous neoplasm ... 1.600 4.3e-03
active Crohn's disease -1.183 2.3e-02
interstitial cystitis -2.400 4.2e-05
pediatric high grade glioma -1.600 1.2e-06
group 3 medulloblastoma -1.600 3.4e-03
pilocytic astrocytoma -1.500 6.8e-07
Pick disease -1.400 4.7e-03
ulcerative colitis -1.600 1.8e-06

AA Sequence

HLQTKAYVRQFQVIDNQNLLFELSYKLEANSQ                                          631 - 662

Text Mined References (6)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9789079 1998 A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia.
9582122 1998 RasGRP, a Ras guanyl nucleotide- releasing protein with calcium- and diacylglycerol-binding motifs.