Property Summary

NCBI Gene PubMed Count 12
PubMed Score 41.02
PubTator Score 192.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-02
astrocytic glioma -2.400 3.5e-02
Astrocytoma, Pilocytic -1.900 2.6e-06
atypical teratoid / rhabdoid tumor -1.500 8.0e-07
Breast cancer 1.100 1.5e-02
cystic fibrosis 1.165 4.0e-04
ependymoma -1.600 2.5e-03
glioblastoma -1.400 1.6e-05
group 3 medulloblastoma -1.600 1.3e-02
interstitial cystitis 1.200 1.2e-04
lung adenocarcinoma -1.400 7.2e-16
lung cancer -2.700 2.3e-04
lung carcinoma -2.000 1.1e-17
malignant mesothelioma -1.500 4.5e-07
medulloblastoma, large-cell 1.200 6.6e-05
nephrosclerosis 1.450 1.8e-04
non-small cell lung cancer -1.260 3.1e-13
oligodendroglioma -1.800 1.2e-09
primitive neuroectodermal tumor -1.200 1.1e-02
subependymal giant cell astrocytoma -2.179 2.8e-03

Gene RIF (1)

AA Sequence

MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVPYFKYIDEEDEDDEWSSRSQSSTEDDSVDSLLSDRY      1 - 70
VVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDV     71 - 140
PRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE    141 - 210
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAE    211 - 280
EDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLA    281 - 350
LELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKF    351 - 420
IKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMK    421 - 490
PPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHL    491 - 560
YVIDSQQALFELSHRIEPRV                                                      561 - 580
//

Text Mined References (12)

PMID Year Title