Property Summary

Ligand Count 15
NCBI Gene PubMed Count 43
PubMed Score 289.70
PubTator Score 54.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.647 1.5e-03
adult high grade glioma -2.100 1.4e-02
astrocytoma -2.000 1.8e-14
Astrocytoma, Pilocytic -1.200 4.9e-02
atypical teratoid / rhabdoid tumor -4.500 3.3e-10
ependymoma -3.200 3.5e-02
glioblastoma -2.000 5.3e-04
group 3 medulloblastoma -4.100 1.1e-03
lung adenocarcinoma -1.300 1.7e-14
lung cancer 1.600 2.3e-04
lung carcinoma 1.400 5.6e-10
malignant mesothelioma -3.300 4.2e-09
medulloblastoma, large-cell -4.500 3.9e-06
nephrosclerosis 1.020 4.1e-03
non-small cell lung cancer -1.246 4.6e-17
oligodendroglioma -2.100 5.5e-13
pituitary cancer 1.800 2.6e-05
primitive neuroectodermal tumor -2.300 7.8e-03
psoriasis -1.200 5.5e-04
urothelial carcinoma -1.400 4.4e-03

Gene RIF (27)

AA Sequence

MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITL      1 - 70
FRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQ     71 - 140
KDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKILRAGKIL    141 - 210
RNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHF    211 - 280
QDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEE    281 - 350
LLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD    351 - 420
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQG    421 - 490
NSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQPSQ    491 - 560
GTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAALKEQLPELEKIV    561 - 630
KQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVA    631 - 700
DKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFEL    701 - 770
MSSKDLAYQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR    771 - 840
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYR    841 - 910
LTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNH    911 - 980
QDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP                                           981 - 1011
//

Text Mined References (45)

PMID Year Title