Property Summary

NCBI Gene PubMed Count 127
PubMed Score 340.75
PubTator Score 277.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.749 1.3e-07
psoriasis -1.100 5.3e-03
osteosarcoma -1.989 1.5e-04
medulloblastoma -1.300 4.8e-06
atypical teratoid/rhabdoid tumor -1.600 6.6e-10
glioblastoma -1.200 1.6e-04
medulloblastoma, large-cell -1.500 1.3e-04
primitive neuroectodermal tumor -1.200 8.8e-05
non-small cell lung cancer -1.232 3.4e-28
diabetes mellitus 1.200 2.3e-03
Breast cancer -2.500 3.1e-02
pediatric high grade glioma -1.200 1.3e-05
pilocytic astrocytoma -1.100 1.2e-06
lung adenocarcinoma -1.100 6.3e-09
ductal carcinoma in situ -1.500 5.5e-05
invasive ductal carcinoma -1.700 2.6e-04
ovarian cancer 1.300 2.0e-06

Protein-protein Interaction (1)

Gene RIF (113)

PMID Text
26979996 EPAC activity is increased in arterial endothelial cells exposed to laminar-fluid shear stress, activation of EPAC1, and its activation of Rap1, plays a role in promoting alignment and elongation of these cells in the direction of flow.
26589262 The cAMP exerted divergent effects on proliferation and promoted cell adhesion of different neuroendocrine cell types, these effects being mediated by both Epac and PKA and involving the same effector GTPase Rap1.
26388312 EPAC activation consistently reverses clinical and experimental impairment of neutrophil phagocytosis. EPAC signals through Rap-1 and bypasses RhoA. EPAC activation represents a novel potential means by which to reverse impaired neutrophil phagocytosis.
26119090 findings, coupled with the development of EPAC specific small molecule modulators, validate EPAC1 as a promising target for therapeutic interventions
25955407 Impaired microtubule dynamics, due to reduced EPAC1 signaling, links CFTR function to cystic fibrosis cellular events.
25913012 association of ezrin with the actin cytoskeleton and phosphorylation on Thr567 are required, but not sufficient, for PKA and EPAC1 to synergistically promote cell spreading following elevations in intracellular cAMP.
25683912 Identified a conserved nuclear pore localisation signal (NPLS; amino acids 764-838 of EPAC1) in the catalytic domains of the cAMP-sensors, EPAC1 and EPAC2A. EPAC1 and EPAC2, display distinct subcellular distributions.
25406016 prostacyclin regulates bone growth via the Epac/Rap1 pathway
25372777 Thyroid carcinoma cell lines showed no or very weak EPAC1 expression and exhibited no growth-promoting effect after EPAC stimulation.
25159528 Sequestration of sperm Rab27 prevents subsequent cAMP/Epac-dependent calcium mobilization from the acrosome.
25122553 EPAC1 and EPAC2 are critical signaling intermediates in osteoclast differentiation that permit RANKL-stimulated NFkB nuclear translocation and actin rearrangements
24994109 Our data may suggest that the downregulation of pulmonary Epac1 expression in COPD patients is related to the upregulation of miRNA-7
24733293 These results demonstrate that glucagon increases hepatic FGF21 secretion via a posttranscriptional mechanism and provide evidence that both the PKA branch and EPAC branch of the cAMP pathway play a role in mediating this effect.
24725364 These data suggested that Epac1 in melanoma cells regulates melanoma progression via the HS-FGF2-mediated cell-cell communication.
24631457 AP1 activation and SOCS3 induction by EPAC1 in human umbilical vein endothelial cells occur independently of c-Jun phosphorylation on Ser63.
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24453361 Authors have shown that Epac-specific inhibitor treatment or silencing Epac-1 gene expression rendered cells resistant to Middle East respiratory syndrome coronavirus infection.
24316969 Loss of epithelial integrity in tumorigenesis involves activation of RAP1 via exchange protein directly activated by cAMP (EPAC).
23968295 cAMP binding to EPAC1 may involve, in addition to the waters from within the first coordination sphere, also some waters from the second coordination sphere of the protein and cAMP.
23804752 data show the expression of EPAC is blunted in HPRT-deficient neuron-like cell lines and fibroblast cells from Lesch-Nyhan syndrome (LNS) patients; propose that the alterations in EPAC/RAP1 signaling and cell migration in HPRT deficiency are crucial for neuro-developmental events that may contribute to neurological dysfunctions in LNS
23797058 the inhibitory effect of cAMP on migration, ruffling, focal adhesion dynamics and paxillin localisation is mediated by PKA, whilst EPAC potentiates migration.
23720748 Data indicate that Epac1-Rap1A-RhoA-ROCK signaling affects Cl- secretion via effects on the apical expression of KCNN4c channels.
23646189 Epac1, a downstream effector of cAMP, functions as a pro-inflammatory modulator in prostate cancer cells.
23523631 cAMP signalling decreases the level of the p300 protein by promoting its ubiquitin-proteasome dependent degradation, which is mediated by Epac and p38 MAPK
23352189 These data provide evidence for the involvement of the Epac/Rap1 signaling pathway in cAMP-mediated decidualization of human endometrial stromal cells.
23266473 Epac1 competes with PDE4D5 to interact with beta-arrestin2 under beta2AR activation
23220153 Taken together the results collected indicate that Epac may have an important role in the cardiac response to stress.
22759971 cAMP increases adhesion of microvascular smooth muscle cells to fibronectin via an Epac mediated mechanism
22575451 cAMP signaling system inhibits the repair of gamma-ray-induced DNA damage by promoting the ubiquitin-proteasome dependent degradation of XRCC1 in an Epac1-dependent pathway in lung cancer cells.
22511766 Data uncover a new Epac-Rap1-dependent pathway by which endothelial cells can regulate WPB exocytosis in response to agonists that signal through cAMP.
22479536 Activation of protein kinase A and exchange protein directly activated by cAMP promotes adipocyte differentiation of human mesenchymal stem cells
22474076 HIF-1alpha binding to the Epac1 promoter recruits hematopoietic stem cells to the ischemic brain following stroke
22363678 Cigarette smoke extract decreased Epac1 expression, but did not affect Epac2 and PKA expression.
22343288 cAMP induces a conformational change in Epac1 that enables DEP domain-mediated binding to phosphatidic acid, resulting in the tethering of Epac1 at the plasma membrane and subsequent activation of Rap
22173835 during Epac1-induced activation of mTORC1 and mTORC2, Epac1 may have an additional function as a "scaffold" protein
22167199 Induction of intracellular calcium concentration by environmental benzo(a)pyrene involves a beta2-adrenergic receptor/adenylyl cyclase/Epac-1/inositol 1,4,5-trisphosphate pathway in endothelial cells
22110680 acidosis/GPR4 signaling regulates endothelial cell adhesion mainly through the G(s)/cAMP/Epac pathway
22082266 Epac1 regulated cell adhesion, leukocyte chemotaxis, phagocytosis and bacterial killing. [review]
22082156 Knockdown of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3; CAMP-GEFI) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21840392 activation of Epac1 increases the formation of cortical actin bundles at the cell-cell junctions, inhibits junction motility and restores barrier function of PDZ-GEFs depleted, but not Rap1 depleted cells
21750123 Epac1 is expressed in human neutrophils and is involved in cAMP-dependent regulation of Rap1. However, the loading of GTP on Rap1 per se is not sufficient to promote activation of beta2 integrins.
21679469 Gbetagamma inhibits Epac-induced Ca 2+ elevation in melanoma cells. Cross talk of Ca 2+ signaling between Gbetagamma & Epac plays a major role in melanoma cell migration.
21670213 Data show that Epac1 directly interacts with the zinc fingers of RanBP2, tethering Epac1 to the nuclear pore complex, revealing a novel mechanism of Epac1 regulation and an unexpected link between the NPC and cAMP signaling.
21539721 Epac1 plays a critical role in melanoma metastasis presumably because of modification of heparan sulfate.
21454546 cAMP-responsive Rap1 guanine nucleotide exchange factor, Epac, induces smooth muscle relaxation by down-regulation of RhoA activity
21393242 PDE3B and EPAC1 bind directly through protein-protein interactions
21166931 results support the hypothesis that cAMP not localized to a specific signaling pathway can activate EPACs which inhibit ATP release via activation of PKC and suggest a novel role for EPACs in erythrocytes
21109603 Adenosine A(B) receptors mediate an early induction of NR4A1 and a decrease in cell proliferation via the cAMP/Epac pathway in coronary artery smooth muscle cells.
21047789 the identification of radixin as a scaffolding unit for both cAMP effectors, Epac and PKA
20952690 -induced activation of GpIb-V-IX triggers platelet procoagulant activity and anchorage of a star-like fibrin network.
20855527 Data suggest that ezrin-radixin-moesin proteins are involved in the spatial regulation of Epac1 and cooperate with cAMP- and Rap-mediated signaling to regulate adhesion to the extracellular matrix.
20732872 PDE4D tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability
20729327 Activation of protein kinase A (PKA)stimulates dendritic cell maturation, while Epac signaling does not affect maturation. Epac suppresses the effects of PKA when both pathways are activated simultaneously.
20663796 Epac1 & Epac2 signaling pathways may be associated with cAMP-mediated functional differentiation and syncytialization of trophoblasts. Expression of Epac1 & Epac 2 in placenta at different stages was investigated.
20547757 Ran-GTP and Epac1 interact with each other in vivo and in vitro. This binding requires a previously uncharacterized Ras association domain in Epac1.
20054824 Conclude that beta-NAD regulates the pulmonary endothelial cell barrier integrity via small GTPase Rac1- and MLCP- dependent signaling pathways.
20038525 These results led us to conclude that the Epac-Rap-PLC-[Ca2+]i signaling pathway is involved in cAMP-stimulated Cl- secretion, which is carried by a novel, previously undescribed Cl- channel.
20032304 Data show that actin bundle formation and subsequent linkage between actin bundles and VE-cadherin through alpha- and beta-catenins are important for the stabilization of VE-cadherin at the cell-cell contacts in cAMP-Epac-Rap1 signal-activated cells.
19920825 Epac inhibits migration and proliferation of human prostate carcinoma cells.
19725049 EPAC-mediated cellular effects require activation of the B-Raf/ERK and mTOR signaling cascades
19710505 These results identify Epac and Rap1 as inhibitory regulators of the angiogenic process
19657062 Epac regulates melanoma cell migration/metastasis mostly via syndecan-2 translocation and heparan sulfate production.
19582788 Prostaglandin E2 inhibits the proliferation of human gingival fibroblasts via the EP2 receptor and Epac
19564576 Epac activation inhibits leukocyte apoptosis significantly.
19546222 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis.
19475578 Subjects with haplotypes G-C-C and A-C-T had significantly higher and lower GFS-USA scores, respectively. Both samples showed an association between Epac-1 gene variants and anxiety and depression, but for different variants or in opposite directions
19475578 Observational study of gene-disease association. (HuGE Navigator)
19464664 prostaglandin E2 activates Rap1 via EP2/EP4 receptors and cAMP-signaling: involvement of Epac1 and PKA
19460752 Knockdown of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3; CAMP-GEFI) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19403523 cGMP is recognized by EPAC in an anti conformation and generates several short and long range perturbations.
19307216 Bacillus anthracis edema toxin altered the protein levels and activity of protein kinase A and exchange protein activated by cAMP (Epac), a recently identified cAMP-binding molecule.
19273589 Results suggest that the regulation of Epac1-Rap signaling by cAMP includes both the release of Epac1 from autoinhibition and its recruitment to the plasma membrane.
19022848 the AC/cAMP/Epac signaling pathway in ovary may mediate the up-regulation of EGFR by gonadotropins via ERK1/2 and Akt activation
18728186 The distribution of DNA-PK between nuclear and cytoplasmic compartments can thus potentially be influenced by relative inputs of cAMP signaling through the EPAC and PKA pathways.
18648773 Epac1 rather than the classic cAMP effector PKA is a crucial element in the signal transduction pathway mediating anti-proliferative effects
18580452 Suggest a role for cAMP/Epac1/Rap1 pathway in regulating proliferation of pancreatic carcinoma cells.
18495799 Epac1 and Epac2 were expressed at the brush border of proximal tubules cells and in the thick ascending limbs of Henle's loop.
18434542 The regulation of Epac expression and activation thus appear to be critical for the integration of pro- and anti-fibrotic signals and for the regulation of fibroblast function.
18421013 The selective use of PKA and Epac-1 pathways to inhibit distinct aspects of fibroblast activation illustrate the pleiotropic ability of PGE(2) to inhibit diverse fibroblast functions.
18323524 Epac1 is mainly expressed in human heart as compared with Epac2 isoform and is increased in heart failure
18202100 There exists in human beta-cells and rat INS-1 cells a novel form of ion channel modulation in which the ATP sensitivity of K(ATP) channels is regulated by Epac.
18172027 Epac1 was shown to be responsible for these actin changes and to colocalize with microtubules in human umbilical vein endothelial cells.
18064650 These results suggest a novel mechanism of ANP protective effects against agonist-induced pulmonary endothelial cell barrier dysfunction via inhibition of Rho signaling by Epac/Rap1-Rac and PKA signaling cascades.
18032709 These data demonstrate that activation of Epac1 increases integrin activity and integrin-dependent homing functions of progenitor cells.
17993585 Evidence for involvement of EPAC or an EPAC-like cAMP effector protein in inhibition of human airwway smooth muscle proliferation.
17895245 Protein kinase A, not Epac, suppresses hedgehog activity and regulates glucocorticoid sensitivity in acute lymphoblastic leukemia cells
17884339 Cells can contain several non-overlapping PKA- and EPAC-based signaling complexes that allow PDE4D/PDE3B coordination of cell adhesion.
17599964 Epac increased ryanodine receptor phosphorylation at the CaMKII site. Reveal a new signalling pathway by which cAMP governs Ca(2+) release and signalling in cardiac myocytes.
17565009 Epac1 activation in HUVEC results in ERK1/2 activation, and this protein, at least in part, mediates response to the physiologically relevant event of A(2B)AR stimulation
17284589 Epac1 and Epac2 induce a potent activation of the Ca2+-sensitive big K+ channel, slight membrane hyperpolarization, and increased after-hyperpolarization in cultured cerebellar granule cells. These effects involve activation of Rap and p38 MAPK.
17203972 Epac1 inhibits TGFbeta-dependent regulation of cell migration and adhesion through TbetaRI
17068197 Rap1 mediates cyclic AMP-stimulated neurotensin secretion downstream of both Epac and protein kinase A signaling pathways
16940330 activation of Epac1, stimulation of cells with serotonin to induce cAMP production resulted in Rap1 activation, increased cell adhesion and polarization, and enhanced chemotaxis.
16914720 These data argue for the existence of a novel cAMP/Epac/Rap1/SOCS-3 pathway for limiting IL-6 receptor signaling in Endothelial Cells and illuminate a new mechanism by which cAMP may mediate its potent anti-inflammatory effects.
16880999 These results demonstrate that Epac plays an important role in connecting the microtubule cytoskeleton network and intracellular cAMP-signalling.
16754664 GPCRs rapidly activate R-Ras; R-Ras activation by the GPCRs is apparently directly induced by cyclic AMP-regulated Epac proteins; and activated R-Ras specifically controls GPCR-mediated phospholipase D stimulation
16751380 The Epac1-Rap1 pathway is present in both monocytes and macrophages, but only regulates specific immune effector functions in macrophages.
16728394 Epac1 and cAMP-dependent protein kinase holoenzyme have similar cAMP affinity, but different cAMP domains
16115630 Results suggest that in human umbilical vein endothelial cells Epac1 controls VE-cadherin-mediated cell junction formation and induces reorganization of the actin cytoskeleton.
15601837 cAMP-Epac-Rap1 signaling promotes decreased cell permeability by enhancing VE-cadherin-mediated adhesion lined by the rearranged cortical actin
15591041 MAP1A LC2 is a biological enhancer of EPAC1 activity toward Rap1 and associated downstream signaling mechanisms
15545605 intracellular cAMP dynamics and Epac activation
15374886 Activation of Epac results in markedly enhanced basal endothelial barrier function by increasing cortical actin and subsequent redistribution of adherens and tight junctional molecules to cell-cell contacts
15319437 Epac- and Ca2+ control activation of Ras and extracellular signal-regulated kinases by Gs-coupled receptors
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
15274052 Observational study of gene-disease association. (HuGE Navigator)
15202935 a novel protein-binding partner for EPAC1 and EPAC2, light chain 2 of MAP1A (microtubule-associated protein 1A)
15166221 Epac-Rap signaling promotes cadherin-mediated cell-cell adhesions
14615375 results demonstrate that B-CLL cells uniquely activate Rap1 in response to PDE4 inhibitors and suggest that physiologic stimuli that activate EPAC may transmit an antiapoptotic signal
12783872 Epac signals to the JNK cascade through a new mechanism that does not involve its canonical catalytic action
12707263 the LID region plays a pivotal role in the communication between the regulatory and catalytic part of Epac
12000763 the subcellular localization of Epac is cell cycle-dependent, it disassociates from the nuclear membrane and localizes to the mitotic spindle and centrosomes in metaphase so may play an important role in mitosis
11801596 role in regulating protein kinase B activity

AA Sequence

MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLLEHQRPSCIQG      1 - 70
LRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGIL     71 - 140
ALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVRTHEMEEELAEAVALLSQ    141 - 210
RGPDALLTVALRKPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKG    211 - 280
TSWYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVE    281 - 350
AKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD    351 - 420
FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFL    421 - 490
QKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKV    491 - 560
PYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERL    561 - 630
FVVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVT    631 - 700
TANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLA    701 - 770
HTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE    771 - 840
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDN    841 - 910
QRELSRLSRELEP                                                             911 - 923
//

Text Mined References (128)

PMID Year Title
26979996 2016 EPAC1 promotes adaptive responses in human arterial endothelial cells subjected to low levels of laminar fluid shear stress: Implications in flow-related endothelial dysfunction.
26589262 2015 cAMP effects in neuroendocrine tumors: The role of Epac and PKA in cell proliferation and adhesion.
26388312 2016 Exchange protein directly activated by cyclic AMP (EPAC) activation reverses neutrophil dysfunction induced by ?2-agonists, corticosteroids, and critical illness.
26119090 2015 Exchange protein directly activated by cAMP encoded by the mammalian rapgef3 gene: Structure, function and therapeutics.
25955407 2015 Role of Exchange Protein Activated by cAMP 1 in Regulating Rates of Microtubule Formation in Cystic Fibrosis Epithelial Cells.
25913012 2015 Phosphorylation of ezrin on Thr567 is required for the synergistic activation of cell spreading by EPAC1 and protein kinase A in HEK293T cells.
25683912 2015 The cAMP sensors, EPAC1 and EPAC2, display distinct subcellular distributions despite sharing a common nuclear pore localisation signal.
25406016 2015 Prostacyclin regulates bone growth via the Epac/Rap1 pathway.
25372777 2015 Expression of the cAMP binding protein EPAC1 in thyroid tumors and growth regulation of thyroid cells and thyroid carcinoma cells by EPAC proteins.
25159528 2014 Epac, Rap and Rab3 act in concert to mobilize calcium from sperm's acrosome during exocytosis.
25122553 2014 Activation of EPAC1/2 is essential for osteoclast formation by modulating NF?B nuclear translocation and actin cytoskeleton rearrangements.
24994109 2014 Interaction between Epac1 and miRNA-7 in airway smooth muscle cells.
24733293 2014 Glucagon stimulates hepatic FGF21 secretion through a PKA- and EPAC-dependent posttranscriptional mechanism.
24725364 2014 Epac1 increases migration of endothelial cells and melanoma cells via FGF2-mediated paracrine signaling.
24631457 2014 The role of c-Jun in controlling the EPAC1-dependent induction of the SOCS3 gene in HUVECs.
24453361 2014 Blocking of exchange proteins directly activated by cAMP leads to reduced replication of Middle East respiratory syndrome coronavirus.
24316969 2014 Increased sugar uptake promotes oncogenesis via EPAC/RAP1 and O-GlcNAc pathways.
23968295 2013 Ultrasonic and densimetric characterization of the association of cyclic AMP with the cAMP-binding domain of the exchange protein EPAC1.
23867755 2013 Involvement of Epac1/Rap1/CaMKI/HDAC5 signaling cascade in the regulation of placental cell fusion.
23804752 2013 Deficiency of the purine metabolic gene HPRT dysregulates microRNA-17 family cluster and guanine-based cellular functions: a role for EPAC in Lesch-Nyhan syndrome.
23797058 2013 cAMP inhibits migration, ruffling and paxillin accumulation in focal adhesions of pancreatic ductal adenocarcinoma cells: effects of PKA and EPAC.
23720748 2013 The Epac1 signaling pathway regulates Cl- secretion via modulation of apical KCNN4c channels in diarrhea.
23646189 2013 Evidence for a pro-proliferative feedback loop in prostate cancer: the role of Epac1 and COX-2-dependent pathways.
23523631 2013 cAMP signalling decreases p300 protein levels by promoting its ubiquitin/proteasome dependent degradation via Epac and p38 MAPK in lung cancer cells.
23352189 2013 Regulation of decidualization in human endometrial stromal cells through exchange protein directly activated by cyclic AMP (Epac).
23266473 2013 Specific interactions between Epac1, ?-arrestin2 and PDE4D5 regulate ?-adrenergic receptor subtype differential effects on cardiac hypertrophic signaling.
23220153 2013 Epac in cardiac calcium signaling.
22759971 2012 cAMP induces adhesion of microvascular smooth muscle cells to fibronectin via an Epac-mediated but PKA-independent mechanism.
22575451 2012 The cAMP signaling system inhibits the repair of ?-ray-induced DNA damage by promoting Epac1-mediated proteasomal degradation of XRCC1 protein in human lung cancer cells.
22511766 2012 The Epac-Rap1 signaling pathway controls cAMP-mediated exocytosis of Weibel-Palade bodies in endothelial cells.
22479536 2012 Activation of protein kinase A and exchange protein directly activated by cAMP promotes adipocyte differentiation of human mesenchymal stem cells.
22474076 2012 HIF-1? binding to the Epac1 promoter recruits hematopoietic stem cells to the ischemic brain following stroke.
22363678 2012 Anti-inflammatory role of the cAMP effectors Epac and PKA: implications in chronic obstructive pulmonary disease.
22343288 2012 cAMP regulates DEP domain-mediated binding of the guanine nucleotide exchange factor Epac1 to phosphatidic acid at the plasma membrane.
22173835 2012 Upregulation of mTORC2 activation by the selective agonist of EPAC, 8-CPT-2Me-cAMP, in prostate cancer cells: assembly of a multiprotein signaling complex.
22167199 2012 Induction of intracellular calcium concentration by environmental benzo(a)pyrene involves a ?2-adrenergic receptor/adenylyl cyclase/Epac-1/inositol 1,4,5-trisphosphate pathway in endothelial cells.
22110680 2011 Activation of GPR4 by acidosis increases endothelial cell adhesion through the cAMP/Epac pathway.
22082266 2011 Role of Epac proteins in mechanisms of cAMP-dependent immunoregulation.
21840392 2011 Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control.
21750123 2011 Exchange protein directly activated by cAMP 1 (Epac1) is expressed in human neutrophils and mediates cAMP-dependent activation of the monomeric GTPase Rap1.
21679469 2011 G?? subunits inhibit Epac-induced melanoma cell migration.
21670213 2011 The nucleoporin RanBP2 tethers the cAMP effector Epac1 and inhibits its catalytic activity.
21539721 2011 Epac1 promotes melanoma metastasis via modification of heparan sulfate.
21454546 2011 The cAMP-responsive Rap1 guanine nucleotide exchange factor, Epac, induces smooth muscle relaxation by down-regulation of RhoA activity.
21393242 2011 A phosphodiesterase 3B-based signaling complex integrates exchange protein activated by cAMP 1 and phosphatidylinositol 3-kinase signals in human arterial endothelial cells.
21166931 2011 Inhibition of ATP release from erythrocytes: a role for EPACs and PKC.
21109603 2011 A?B receptors mediate the induction of early genes and inhibition of arterial smooth muscle cell proliferation via Epac.
21047789 2011 Radixin assembles cAMP effectors Epac and PKA into a functional cAMP compartment: role in cAMP-dependent cell proliferation.
20952690 2011 AKAP9 regulation of microtubule dynamics promotes Epac1-induced endothelial barrier properties.
20855527 2010 Spatial regulation of cyclic AMP-Epac1 signaling in cell adhesion by ERM proteins.
20732872 2010 Cyclic AMP phosphodiesterase 4D (PDE4D) Tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability.
20729327 2010 Crosstalk between PKA and Epac regulates the phenotypic maturation and function of human dendritic cells.
20663796 2010 Possible role of the exchange protein directly activated by cyclic AMP (Epac) in the cyclic AMP-dependent functional differentiation and syncytialization of human placental BeWo cells.
20547757 2010 The interaction of Epac1 and Ran promotes Rap1 activation at the nuclear envelope.
20054824 2010 Extracellular beta-nicotinamide adenine dinucleotide (beta-NAD) promotes the endothelial cell barrier integrity via PKA- and EPAC1/Rac1-dependent actin cytoskeleton rearrangement.
20038525 2010 Epac1 mediates protein kinase A-independent mechanism of forskolin-activated intestinal chloride secretion.
20032304 2010 Vascular endothelial-cadherin stabilizes at cell-cell junctions by anchoring to circumferential actin bundles through alpha- and beta-catenins in cyclic AMP-Epac-Rap1 signal-activated endothelial cells.
19920825 2009 Epac inhibits migration and proliferation of human prostate carcinoma cells.
19725049 2009 Epac1-induced cellular proliferation in prostate cancer cells is mediated by B-Raf/ERK and mTOR signaling cascades.
19710505 2009 A novel interplay between Epac/Rap1 and mitogen-activated protein kinase kinase 5/extracellular signal-regulated kinase 5 (MEK5/ERK5) regulates thrombospondin to control angiogenesis.
19657062 2009 Epac increases melanoma cell migration by a heparan sulfate-related mechanism.
19582788 2009 Prostaglandin E2 inhibits the proliferation of human gingival fibroblasts via the EP2 receptor and Epac.
19564576 2009 Epac inhibits apoptosis of human leukocytes.
19546222 2009 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis.
19475578 2010 An association between Epac-1 gene variants and anxiety and depression in two independent samples.
19464664 2009 Prostaglandin E2 activates Rap1 via EP2/EP4 receptors and cAMP-signaling in rheumatoid synovial fibroblasts: involvement of Epac1 and PKA.
19403523 2009 Dynamically driven ligand selectivity in cyclic nucleotide binding domains.
19307216 2009 Bacillus anthracis edema toxin suppresses human macrophage phagocytosis and cytoskeletal remodeling via the protein kinase A and exchange protein activated by cyclic AMP pathways.
19273589 2009 Direct spatial control of Epac1 by cyclic AMP.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19022848 2009 Gonadotropin-stimulated epidermal growth factor receptor expression in human ovarian surface epithelial cells: involvement of cyclic AMP-dependent exchange protein activated by cAMP pathway.
18728186 2008 EPAC and PKA allow cAMP dual control over DNA-PK nuclear translocation.
18648773 2008 Role of Epac1 in mediating anti-proliferative effects of prostanoid EP(2) receptors and cAMP in human lung fibroblasts.
18580452 2008 The cAMP/Epac1/Rap1 pathway in pancreatic carcinoma.
18495799 2008 Renal expression of exchange protein directly activated by cAMP (Epac) 1 and 2.
18434542 2008 The cyclic AMP effector Epac integrates pro- and anti-fibrotic signals.
18421013 2008 Prostaglandin E2 inhibits specific lung fibroblast functions via selective actions of PKA and Epac-1.
18323524 2008 Epac mediates beta-adrenergic receptor-induced cardiomyocyte hypertrophy.
18202100 2008 Role of the cAMP sensor Epac as a determinant of KATP channel ATP sensitivity in human pancreatic beta-cells and rat INS-1 cells.
18172027 2008 Role of Epac1, an exchange factor for Rap GTPases, in endothelial microtubule dynamics and barrier function.
18064650 2008 Epac/Rap and PKA are novel mechanisms of ANP-induced Rac-mediated pulmonary endothelial barrier protection.
18032709 2008 Activation of Epac stimulates integrin-dependent homing of progenitor cells.
17993585 2008 Inhibition of human airway smooth muscle cell proliferation by beta 2-adrenergic receptors and cAMP is PKA independent: evidence for EPAC involvement.
17895245 2007 Protein kinase A, not Epac, suppresses hedgehog activity and regulates glucocorticoid sensitivity in acute lymphoblastic leukemia cells.
17884339 2007 Numerous distinct PKA-, or EPAC-based, signalling complexes allow selective phosphodiesterase 3 and phosphodiesterase 4 coordination of cell adhesion.
17599964 2007 The cAMP binding protein Epac modulates Ca2+ sparks by a Ca2+/calmodulin kinase signalling pathway in rat cardiac myocytes.
17565009 2007 Cyclic AMP-dependent, protein kinase A-independent activation of extracellular signal-regulated kinase 1/2 following adenosine receptor stimulation in human umbilical vein endothelial cells: role of exchange protein activated by cAMP 1 (Epac1).
17284589 2007 Exchange protein activated by cAMP (Epac) mediates cAMP activation of p38 MAPK and modulation of Ca2+-dependent K+ channels in cerebellar neurons.
17203972 2007 Interactome of transforming growth factor-beta type I receptor (TbetaRI): inhibition of TGFbeta signaling by Epac1.
17068197 2007 Cyclic adenosine 5'-monophosphate-stimulated neurotensin secretion is mediated through Rap1 downstream of both Epac and protein kinase A signaling pathways.
16940330 2006 Epac1-Rap1 signaling regulates monocyte adhesion and chemotaxis.
16914720 2006 Exchange protein activated by cyclic AMP (Epac)-mediated induction of suppressor of cytokine signaling 3 (SOCS-3) in vascular endothelial cells.
16880999 2005 Interplay between exchange protein directly activated by cAMP (Epac) and microtubule cytoskeleton.
16754664 2006 Cyclic AMP-dependent and Epac-mediated activation of R-Ras by G protein-coupled receptors leads to phospholipase D stimulation.
16751380 2006 The cyclic AMP-Epac1-Rap1 pathway is dissociated from regulation of effector functions in monocytes but acquires immunoregulatory function in mature macrophages.
16728394 2006 Epac1 and cAMP-dependent protein kinase holoenzyme have similar cAMP affinity, but their cAMP domains have distinct structural features and cyclic nucleotide recognition.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177794 2005 The protein kinase A anchoring protein mAKAP coordinates two integrated cAMP effector pathways.
16115630 2005 Epac1 regulates integrity of endothelial cell junctions through VE-cadherin.
16076873 2005 Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.
15601837 2005 Cyclic AMP potentiates vascular endothelial cadherin-mediated cell-cell contact to enhance endothelial barrier function through an Epac-Rap1 signaling pathway.
15591041 2005 MAP1A light chain 2 interacts with exchange protein activated by cyclic AMP 1 (EPAC1) to enhance Rap1 GTPase activity and cell adhesion.
15545605 2004 Fluorescent indicators of cAMP and Epac activation reveal differential dynamics of cAMP signaling within discrete subcellular compartments.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374886 2005 Regulation of vascular endothelial barrier function by Epac, a cAMP-activated exchange factor for Rap GTPase.
15334074 2004 CalDAG-GEFI integrates signaling for platelet aggregation and thrombus formation.
15319437 2004 Epac- and Ca2+ -controlled activation of Ras and extracellular signal-regulated kinases by Gs-coupled receptors.
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15274052 2004 Association study of the Epac gene and tobacco smoking and nicotine dependence.
15202935 2004 Exchange protein directly activated by cAMP (EPAC) interacts with the light chain (LC) 2 of MAP1A.
15166221 2004 Rap1 regulates E-cadherin-mediated cell-cell adhesion.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615375 2004 Among circulating hematopoietic cells, B-CLL uniquely expresses functional EPAC1, but EPAC1-mediated Rap1 activation does not account for PDE4 inhibitor-induced apoptosis.
12783872 2003 Activation of JNK by Epac is independent of its activity as a Rap guanine nucleotide exchanger.
12707263 2003 Communication between the regulatory and the catalytic region of the cAMP-responsive guanine nucleotide exchange factor Epac.
12574122 2003 Mechanism of the spatio-temporal regulation of Ras and Rap1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469113 2003 Structure and regulation of the cAMP-binding domains of Epac2.
12384139 2002 Ras and relatives--job sharing and networking keep an old family together.
12000763 2002 Cell cycle-dependent subcellular localization of exchange factor directly activated by cAMP.
10777494 2000 Mechanism of regulation of the Epac family of cAMP-dependent RapGEFs.
9856955 1998 A family of cAMP-binding proteins that directly activate Rap1.
9853756 1998 Epac is a Rap1 guanine-nucleotide-exchange factor directly activated by cyclic AMP.
9789079 1998 A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.