Property Summary

NCBI Gene PubMed Count 30
PubMed Score 24.98
PubTator Score 14.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.548 5.4e-03
malignant mesothelioma -1.300 1.6e-05
astrocytic glioma -1.100 3.2e-02
ependymoma -1.200 2.3e-02
glioblastoma -1.900 9.4e-05
osteosarcoma -2.195 4.0e-06
atypical teratoid / rhabdoid tumor -1.600 1.3e-03
medulloblastoma -1.500 5.4e-06
medulloblastoma, large-cell -2.900 2.1e-05
hereditary spastic paraplegia -1.019 2.1e-02
pancreatic ductal adenocarcinoma liver m... 1.285 4.5e-02
non-small cell lung cancer -1.406 4.5e-10
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous carcinoma... 1.200 9.9e-03
lung cancer -2.100 9.7e-03
cystic fibrosis -1.600 3.6e-05
adult high grade glioma -1.400 3.2e-03
psoriasis -1.600 6.1e-08
spina bifida -1.126 4.5e-02
Pick disease 1.300 2.7e-02
Breast cancer -2.400 1.6e-40
ovarian cancer -2.300 3.7e-10

Gene RIF (12)

PMID Text
25332235 SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1
25189171 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 local accumulation of PDZGEF at the apical membrane during establishment of epithelial polarity is mediated by electrostatic interactions between positively charged side chains in the PDZ domain and negatively charged phosphatidic acid.
24340059 NEDD4-1 regulates cell migration and invasion through ubiquitination of CNrasGEF in vitro.
24290981 We report that in response to factors that promote cell motility, the Rap guanine exchange factor RAPGEF2 is rapidly phosphorylated by I-kappa-B-kinase-beta and casein kinase-1alpha and consequently degraded by the proteasome.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23800469 Data indicate that expression of Rapgef2 in embryonic kidney 293T cells enables cAMP-Rap1-ERK signaling.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
21840392 PDZ-GEF activates Rap1 under resting conditions to stabilize cell-cell junctions and maintain basal integrity
17724123 Data show that the interaction of PDZ-GEF1 with an internalized neurotrophin receptor transported to late endosomes induces sustained activation of both Rap1 and ERK and neurite outgrowth.
12196628 PSD-95/Dlg/ZO-1 homology (PDZ)-RhoGEF was isolated from mouse brain as a plexin-B1-specific interacting protein
11799111 Regulation of G protein-linked guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and LARG by tyrosine phosphorylation: evidence of a role for focal adhesion kinase

AA Sequence

MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEA      1 - 70
GDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT     71 - 140
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYM    141 - 210
KGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLT    211 - 280
MHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAM    281 - 350
TRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS    351 - 420
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPK    421 - 490
IGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD    491 - 560
DSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSATPDLPDQVLRVFKADQQSRYIMISKDTTA    561 - 630
KEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDE    631 - 700
DAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFW    701 - 770
VASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL    771 - 840
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRM    841 - 910
ASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY    911 - 980
LSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKAQSLPQPQQQPPPAHKI    981 - 1050
NQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTS   1051 - 1120
PQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRME   1121 - 1190
RRTMIEPDQYSLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI   1191 - 1260
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASST   1261 - 1330
GYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP   1331 - 1400
PTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHK   1401 - 1470
PNESDPRLAPYQSQGFSTEEDEDEQVSAV                                            1471 - 1499
//

Text Mined References (38)

PMID Year Title
25332235 2015 Substrate trapping proteomics reveals targets of the ?TrCP2/FBXW11 ubiquitin ligase.
25189171 2014 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 2014 The PDZ domain of the guanine nucleotide exchange factor PDZGEF directs binding to phosphatidic acid during brush border formation.
24340059 2013 NEDD4-1 regulates migration and invasion of glioma cells through CNrasGEF ubiquitination in vitro.
24290981 2013 Control of epithelial cell migration and invasion by the IKK?- and CK1?-mediated degradation of RAPGEF2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23800469 2013 Rapgef2 connects GPCR-mediated cAMP signals to ERK activation in neuronal and endocrine cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22422452 2012 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
21840392 2011 Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17724123 2007 Rap1-PDZ-GEF1 interacts with a neurotrophin receptor at late endosomes, leading to sustained activation of Rap1 and ERK and neurite outgrowth.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16272156 2006 The guanine nucleotide exchange factor CNrasGEF regulates melanogenesis and cell survival in melanoma cells.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391161 2002 Direct binding of the beta1 adrenergic receptor to the cyclic AMP-dependent guanine nucleotide exchange factor CNrasGEF leads to Ras activation.
12196628 2002 The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11799111 2002 Regulation of G protein-linked guanine nucleotide exchange factors for Rho, PDZ-RhoGEF, and LARG by tyrosine phosphorylation: evidence of a role for focal adhesion kinase.
11598133 2001 Nedd4 regulates ubiquitination and stability of the guanine-nucleotide exchange factor CNrasGEF.
11359771 2001 RA-GEF-1, a guanine nucleotide exchange factor for Rap1, is activated by translocation induced by association with Rap1*GTP and enhances Rap1-dependent B-Raf activation.
11168587 2000 Membrane-associated guanylate kinase with inverted orientation (MAGI)-1/brain angiogenesis inhibitor 1-associated protein (BAP1) as a scaffolding molecule for Rap small G protein GDP/GTP exchange protein at tight junctions.
10934204 2000 Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.
10801446 2000 The guanine nucleotide exchange factor CNrasGEF activates ras in response to cAMP and cGMP.
10608883 1999 PDZ-GEF1, a guanine nucleotide exchange factor specific for Rap1 and Rap2.
10608844 1999 RA-GEF, a novel Rap1A guanine nucleotide exchange factor containing a Ras/Rap1A-associating domain, is conserved between nematode and humans.
10548487 1999 nRap GEP: a novel neural GDP/GTP exchange protein for rap1 small G protein that interacts with synaptic scaffolding molecule (S-SCAM).
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.