Property Summary

NCBI Gene PubMed Count 64
PubMed Score 281.19
PubTator Score 101.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 6.3e-08
group 4 medulloblastoma 1855 1.6e-03
COPD 118 9.9e-03
ependymoma 4679 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hemolytic-Uremic Syndrome 30 4.094 2.0
Kidney disease 430 3.74 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
COPD -1.100 9.9e-03
ependymoma 1.400 1.6e-02
group 4 medulloblastoma 1.100 1.6e-03
juvenile dermatomyositis 1.007 6.3e-08

 GWAS Trait (1)

Gene RIF (26)

AA Sequence

MDTDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQ      1 - 70
AVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQ     71 - 140
NDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQ    141 - 210
GRPSPTSPVKPSSPASKPDGPAELPLTDREVEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDN    211 - 280
SPPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGGESPRLSP    281 - 350
CSSIGKLSKSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQIPQQTAWNLSPLPESLGE    351 - 420
SGSPFLGPPFQLPLGGHPQPDGPLAPGQQTDTPPALPEKKRRSAASQTADGSGCRVSYERHPSQYDNISG    421 - 490
EDLQSTAPIPSVPYAPFAAILPFQHGGSSAPVEFVGDFTAPESTGDPEKPPPLPEKKNKHMLAYMQLLED    491 - 560
YSEPQPSMFYQTPQNEHIYQQKNKLLMEVYGFSDSFSGVDSVQELAPPPALPPKQRQLEPPAGKDGHPRD    561 - 630
PSAVSGVPGKDSRDGSERAPKSPDALESAQSEEEVDELSLIDHNEIMSRLTLKQEGDDGPDVRGGSGDIL    631 - 700
LVHATETDRKDLVLYCEAFLTTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELC    701 - 770
LVELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSSQPLAARGVAARPGTLHDFH    771 - 840
SHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLL    841 - 910
LKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPP    911 - 980
CIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLA    981 - 1050
EEALWELSLKIKPRNITRRKTDREEKT                                              1051 - 1077
//

Text Mined References (74)

PMID Year Title