Property Summary

NCBI Gene PubMed Count 33
PubMed Score 178.59
PubTator Score 25.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 GO Function (2)

Gene RIF (14)

PMID Text
26308105 Expression and DNA methylation status of the Rap2B gene in human bronchial epithelial cells treated by cigarette smoke condensate
25762091 Rap2B itself is not necessary for p53-dependent cell cycle arrest.
25663460 Our collective findings provide preliminary evidence that miR-342-3p acts as a tumor suppressor in small cell lung cancer through repression of RAP2B.
24951956 Data indicate that rap GTP-binding protein Rap2B expression is significantly increased in suprarenal epithelioma and Rap2B can promote the cell migration and invasion abilities, suggesting a target for the treatment of suprarenal epithelioma.
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
23535297 Rap2b is a conserved p53-activated gene that counters p53-mediated apoptosis after DNA damage.
23535297 Rap2b mediates the pro-survival function of p53 upon DNA damage.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18582561 These results demonstrate that Rap2b, but not the more abundant Rap1b, is associated to lipid rafts in human platelets.
17316888 A cDNA library consisting of 220 upregulated genes in tumour tissue was established and named as LSCC. Differential expression was confirmed in five of these genes, including IGFBP5, SQLE, RAP2B, CLDN1, and TBL1XR1.
15613030 the small GTPase Rap2B is involved in platelet activation
11877431 Stimulation of phospholipase C-epsilon by the M3 muscarinic acetylcholine receptor mediated by cyclic AMP and the GTPase Rap2B

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC     71 - 140
PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL                               141 - 183
//

Text Mined References (37)

PMID Year Title
26308105 2015 Expression and DNA methylation status of the Rap2B gene in human bronchial epithelial cells treated by cigarette smoke condensate.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762091 2015 p53 target gene Rap2B regulates the cytoskeleton and inhibits cell spreading.
25663460 2015 miR-342-3p targets RAP2B to suppress proliferation and invasion of non-small cell lung cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24951956 2014 Rap2B promotes migration and invasion of human suprarenal epithelioma.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23535297 2013 Rap2b, a novel p53 target, regulates p53-mediated pro-survival function.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18582561 2008 Targeting of the small GTPase Rap2b, but not Rap1b, to lipid rafts is promoted by palmitoylation at Cys176 and Cys177 and is required for efficient protein activation in human platelets.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
17316888 2007 Identification of genes differentially expressed in human primary lung squamous cell carcinoma.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16540189 2006 Rap2, but not Rap1 GTPase is expressed in human red blood cells and is involved in vesiculation.
16213650 Identification and biochemical characterization of Rap2C, a new member of the Rap family of small GTP-binding proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15613030 2004 Activation of the small GTPase Rap2B in agonist-stimulated human platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143162 2004 Rap2B-dependent stimulation of phospholipase C-epsilon by epidermal growth factor receptor mediated by c-Src phosphorylation of RasGRP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444546 2002 Differential roles of Ras and Rap1 in growth factor-dependent activation of phospholipase C epsilon.
11877431 2002 Stimulation of phospholipase C-epsilon by the M3 muscarinic acetylcholine receptor mediated by cyclic AMP and the GTPase Rap2B.
11786539 2002 The delta subunit of retinal rod cGMP phosphodiesterase regulates the membrane association of Ras and Rap GTPases.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10085114 1999 Identification and characterization of potential effector molecules of the Ras-related GTPase Rap2.
8424780 1993 Prenyl group identification of rap2 proteins: a ras superfamily member other than ras that is farnesylated.
8391995 1993 Localization of rap1 and rap2 proteins in the gelatinase-containing granules of human neutrophils.
8356055 1993 Association of the low molecular weight GTP-binding protein rap2B with the cytoskeleton during platelet aggregation.
3045729 1988 Human cDNAs rap1 and rap2 homologous to the Drosophila gene Dras3 encode proteins closely related to ras in the 'effector' region.
2118648 1990 RAP2B: a RAS-related GTP-binding protein from platelets.
2115998 1990 cDNA sequence of a new ras-related gene (rap2b) isolated from human platelets with sequence homology to rap2.