Property Summary

NCBI Gene PubMed Count 45
PubMed Score 111.80
PubTator Score 57.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
urothelial carcinoma 1.100 3.6e-02
astrocytic glioma 1.300 1.5e-02
psoriasis 1.700 4.2e-04
osteosarcoma 3.175 7.9e-09
atypical teratoid / rhabdoid tumor -1.100 2.7e-08
medulloblastoma, large-cell -1.100 4.3e-05
Common variable immunodeficiency 1.310 2.2e-02
active Crohn's disease 1.149 1.6e-02
group 3 medulloblastoma -1.300 9.6e-03
posterior fossa group B ependymoma -1.100 9.5e-04
primary Sjogren syndrome 1.200 4.3e-03
lung carcinoma 1.700 3.4e-19
gastric carcinoma 1.200 1.2e-02
ovarian cancer 1.800 1.9e-04

Gene RIF (19)

PMID Text
26488411 Single nucleotide polymorphism in RAP2A gene is associated with Peripheral Arterial Disease.
25980814 present review mainly focused on recent studies on the functional and physical interactions between Rap2 and its effectors. We also speculated on the relevance of these pathways to tumorigenesis
25728512 The ectopic expression of Rap2a enhances the migration and invasive ability of cancer cells and increases activities of matrix metalloproteinase MMP2 and MMP9.
25533468 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25248704 the role of Rap2a in carcinogenesis
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24293123 downregulation of Rap2a promoted glioma migration and invasion, and raised the phosphorylation level of AKT
23469100 endothelial barrier resistance is determined by the combined antagonistic actions of Rap1 and Rap2
22797597 Rap2A and TNIK control brush border formation by apical recruitment of MST4 and the subsequent phosphorylation of Ezrin
19645719 analyzed residues that allow RasGEF1 proteins to discriminate between Rap1 and Rap2, and identified Phe39 in the switch I region of Rap2 as a specificity residue.
18789886 The beta2 integrin-dependent exocytosis of specific and gelatinase B-containing granules is responsible for the translocation of Rap1 and Rap2 to the plasma membrane in human neutrophils.
18701680 Study presents evidence of fewer spines and reduced signaling in Rap2 transgenic mice, consistent with an inhibitory role for Rap2 at synapses.
17918750 Rap2 is involved in androgen-mediated transcriptional and growth responses of human prostate cancer cells.
17716979 interaction surfaces in RAPL-Rap1 and RAPL-Rap2 complexes are different and that a single residue in the switch I region of Rap proteins (residue 39) contributes considerably to the different kinetics of these protein-protein interactions.
16963453 A study that demonstrated the engagement of beta2 integrins on human neutrophils increased the levels of GTP-bound Rap1 and Rap2 is presented.
16540189 RT-PCR analysis of mRNA extracted from highly purified reticulocytes confirmed the expression of Rap2b, but not Rap2a, Rap2c, Rap1a or Rap1b.
16246175 RGS14 activity towards heterotrimeric G-proteins, as either a GAP or a guanine nucleotide dissociation inhibitor, was unaffected by Rap binding.
15342639 TNIK is a specific effector of Rap2 to regulate actin cytoskeleton
14966141 Rap2 enhanced MAP4K4-induced activation of JNK

AA Sequence

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL      1 - 70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC     71 - 140
PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ                               141 - 183
//

Text Mined References (51)

PMID Year Title
26488411 2015 Genome-Wide Association Study of Peripheral Arterial Disease in a Japanese Population.
25980814 2015 Role of Rap2 and its Downstream Effectors in Tumorigenesis.
25728512 2015 Rap2a is a novel target gene of p53 and regulates cancer cell migration and invasion.
25533468 2015 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25248704 2014 [Identification analysis of eukaryotic expression plasmid Rap2a and its effect on the migration of lung cancer cells].
24293123 2014 Over-expression of Rap2a inhibits glioma migration and invasion by down-regulating p-AKT.
23894443 2013 Coiled-coil domain containing protein 124 is a novel centrosome and midbody protein that interacts with the Ras-guanine nucleotide exchange factor 1B and is involved in cytokinesis.
23469100 2013 Rap1 and Rap2 antagonistically control endothelial barrier resistance.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
21269460 2011 Initial characterization of the human central proteome.
20159449 2010 Regulation of Rap2A by the ubiquitin ligase Nedd4-1 controls neurite development.
19645719 2009 RasGEF1A and RasGEF1B are guanine nucleotide exchange factors that discriminate between Rap GTP-binding proteins and mediate Rap2-specific nucleotide exchange.
19061864 2009 Rap2 function requires palmitoylation and recycling endosome localization.
18930710 2008 MINK is a Rap2 effector for phosphorylation of the postsynaptic scaffold protein TANC1.
18789886 2008 Beta2 integrins target Rap GTPases to the plasma membrane by means of degranulation.
18701680 2008 Constitutively active Rap2 transgenic mice display fewer dendritic spines, reduced extracellular signal-regulated kinase signaling, enhanced long-term depression, and impaired spatial learning and fear extinction.
17918750 2007 Rap2 regulates androgen sensitivity in human prostate cancer cells.
17716979 2007 Characterization of interactions of adapter protein RAPL/Nore1B with RAP GTPases and their role in T cell migration.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
16963453 2006 Nitric oxide produced in response to engagement of beta2 integrins on human neutrophils activates the monomeric GTPases Rap1 and Rap2 and promotes adhesion.
16540189 2006 Rap2, but not Rap1 GTPase is expressed in human red blood cells and is involved in vesiculation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16246175 2006 Biochemical characterization of RGS14: RGS14 activity towards G-protein alpha subunits is independent of its binding to Rap2A.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15752761 2005 PARG1, a protein-tyrosine phosphatase-associated RhoGAP, as a putative Rap2 effector.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342639 2004 The Traf2- and Nck-interacting kinase as a putative effector of Rap2 to regulate actin cytoskeleton.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15031288 2004 Identification and characterization of rain, a novel Ras-interacting protein with a unique subcellular localization.
14966141 2004 Mitogen-activated protein kinase kinase kinase kinase 4 as a putative effector of Rap2 to activate the c-Jun N-terminal kinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12581858 2003 Characterisation of PDZ-GEFs, a family of guanine nucleotide exchange factors specific for Rap1 and Rap2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444546 2002 Differential roles of Ras and Rap1 in growth factor-dependent activation of phospholipase C epsilon.
11857081 2002 The putative tumor suppressor RASSF1A homodimerizes and heterodimerizes with the Ras-GTP binding protein Nore1.
11524421 2001 Identification and characterization of RA-GEF-2, a Rap guanine nucleotide exchange factor that serves as a downstream target of M-Ras.
10926822 2000 RGS14 is a novel Rap effector that preferentially regulates the GTPase activity of galphao.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10777494 2000 Mechanism of regulation of the Epac family of cAMP-dependent RapGEFs.
10591105 1999 Structure of the small G protein Rap2 in a non-catalytic complex with GTP.
10572250 1999 Interaction of the low-molecular-weight GTP-binding protein rap2 with the platelet cytoskeleton is mediated by direct binding to the actin filaments.
10224125 1999 Thermodynamic and kinetic characterization of the interaction between the Ras binding domain of AF6 and members of the Ras subfamily.
10085114 1999 Identification and characterization of potential effector molecules of the Ras-related GTPase Rap2.
9523700 1998 Identification of a specific effector of the small GTP-binding protein Rap2.
9312017 1997 Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
8424780 1993 Prenyl group identification of rap2 proteins: a ras superfamily member other than ras that is farnesylated.
8391995 1993 Localization of rap1 and rap2 proteins in the gelatinase-containing granules of human neutrophils.
7962206 1994 Association of Rap1a and Rap1b proteins with late endocytic/phagocytic compartments and Rap2a with the Golgi complex.
3045729 1988 Human cDNAs rap1 and rap2 homologous to the Drosophila gene Dras3 encode proteins closely related to ras in the 'effector' region.
1900290 1991 The product of the rap2 gene, member of the ras superfamily. Biochemical characterization and site-directed mutagenesis.