Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.25
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.800 7.5e-03
ependymoma -1.800 1.1e-02
oligodendroglioma -1.400 2.4e-02
glioblastoma -1.800 8.3e-06
atypical teratoid / rhabdoid tumor -1.800 3.2e-05
group 4 medulloblastoma -1.300 1.7e-05
primitive neuroectodermal tumor -1.200 2.5e-04
tuberculosis and treatment for 6 months 1.200 1.4e-04
lung cancer 2.100 3.8e-04
pediatric high grade glioma -1.600 5.4e-08
pilocytic astrocytoma -1.200 4.8e-08
subependymal giant cell astrocytoma -1.065 2.6e-02
ovarian cancer 2.200 2.0e-05

Gene RIF (18)

PMID Text
26814130 DiRas1 expression inhibits malignant features of cancers in part by nonproductively binding to SmgGDS and inhibiting the binding of other small GTPases to SmgGDS
26598509 results indicate that statins selectively up-regulate SmgGDS in endothelial cells, for which the beta1-integrin/Akt1 pathway may be involved, demonstrating the novel aspects of the pleiotropic effects of statins
24552806 SmgGDS promotes cell cycle progression in multiple types of cancer, making SmgGDS a valuable target for cancer therapeutics.
24415755 this study provides evidence that SmgGDS-607 associates with GTPases through recognition of the last amino acid in the CAAX motif.
24349085 TG2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24197117 findings identify SmgGDS-558 as an activator of RhoA and NF-kB in breast cancer, and demonstrate a functional role for SmgGDS-558 in the proliferation of breast cancer cells and tumorigenesis.
23898208 HIV-1 Tat downregulates the expression of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1; GDS1) in human primary T cells
23640485 These results indicate that statins exert their pleiotropic effects through SmgGDS upregulation with a resultant Rac1 degradation and reduced oxidative stress in animals and humans.
21429211 findings provide compelling evidence of a novel role for junctional adhesion molecule-A (JAM-A)in driving breast cancer cell migration via activation of Rap1 GTPase and beta1-integrin
21242305 Results indicate that SmgGDS is a bona fide GEF that specifically activates RhoA and RhoC through a unique mechanism not used by other Rho family exchange factors.
20709748 Results indicate that guanine nucleotide exchange and interactions with SmgGDS splice variants can regulate the entrance and passage of PBR-possessing small GTPases through the prenylation pathway.
20209136 C3G stimulates guanine nucleotide exchange on Drosophila Rap GTPases in vitro
20190816 ALK activation of Rap1 via the Rap1-specific GEF C3Gmay contribute to cell proliferation and oncogenesis of neuroblastoma.
19546222 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis.
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17951244 SmgGDS promotes the malignant Non-small cell lung carcinoma (NSCLC)phenotype and is an intriguing therapeutic target in NSCLC.
14615375 results demonstrate that B-CLL cells uniquely activate Rap1 in response to PDE4 inhibitors and suggest that physiologic stimuli that activate EPAC may transmit an antiapoptotic signal
12690117 activated by turbulence and is involved in integrin [alpha]IIb[beta]3-mediated cell adhesion in human megakaryocytes

AA Sequence

MDNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFASLLTPQSSCKAKVAN      1 - 70
IIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDHL     71 - 140
RSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLA    141 - 210
ELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDS    211 - 280
DKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDANC    281 - 350
IHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQF    351 - 420
KLLGTLRMLIDAQAEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG    421 - 490
GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC    491 - 560
ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES                           561 - 607
//

Text Mined References (30)

PMID Year Title
26814130 2016 The Tumor-suppressive Small GTPase DiRas1 Binds the Noncanonical Guanine Nucleotide Exchange Factor SmgGDS and Antagonizes SmgGDS Interactions with Oncogenic Small GTPases.
26598509 2016 Statins up-regulate SmgGDS through ?1-integrin/Akt1 pathway in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
24552806 2014 SmgGDS-558 regulates the cell cycle in pancreatic, non-small cell lung, and breast cancers.
24415755 2014 The chaperone protein SmgGDS interacts with small GTPases entering the prenylation pathway by recognizing the last amino acid in the CAAX motif.
24349085 2013 Transglutaminase 2 contributes to apoptosis induction in Jurkat T cells by modulating Ca2+ homeostasis via cross-linking RAP1GDS1.
24197117 2014 The SmgGDS splice variant SmgGDS-558 is a key promoter of tumor growth and RhoA signaling in breast cancer.
23640485 2013 Statins exert the pleiotropic effects through small GTP-binding protein dissociation stimulator upregulation with a resultant Rac1 degradation.
21429211 2011 Breast cancer cell migration is regulated through junctional adhesion molecule-A-mediated activation of Rap1 GTPase.
21269460 2011 Initial characterization of the human central proteome.
21242305 2011 SmgGDS is a guanine nucleotide exchange factor that specifically activates RhoA and RhoC.
20709748 2010 Splice variants of SmgGDS control small GTPase prenylation and membrane localization.
20209136 2010 The Rap1 guanine nucleotide exchange factor C3G is required for preservation of larval muscle integrity in Drosophila melanogaster.
20190816 2010 Anaplastic lymphoma kinase activates the small GTPase Rap1 via the Rap1-specific GEF C3G in both neuroblastoma and PC12 cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19546222 2009 Epac activates the small G proteins Rap1 and Rab3A to achieve exocytosis.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17951244 2008 SmgGDS regulates cell proliferation, migration, and NF-kappaB transcriptional activity in non-small cell lung carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615375 2004 Among circulating hematopoietic cells, B-CLL uniquely expresses functional EPAC1, but EPAC1-mediated Rap1 activation does not account for PDE4 inhibitor-induced apoptosis.
12690117 2003 The small GTPase Rap1 is activated by turbulence and is involved in integrin [alpha]IIb[beta]3-mediated cell adhesion in human megakaryocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948427 2002 SmgGDS displays differential binding and exchange activity towards different Ras isoforms.
8900189 1996 SMAP, an Smg GDS-associating protein having arm repeats and phosphorylated by Src tyrosine kinase.
8262526 1993 Chromosomal assignment of the human smg GDP dissociation stimulator gene to human chromosome 4q21-q25.
1549351 1992 Molecular cloning of the human cDNA for a stimulatory GDP/GTP exchange protein for c-Ki-ras p21 and smg p21.