Property Summary

NCBI Gene PubMed Count 55
PubMed Score 65.36
PubTator Score 57.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma -1.800 8.2e-23
posterior fossa group B ependymoma -2.400 3.6e-17
glioblastoma multiforme -1.900 1.7e-21
oligodendroglioma -1.700 2.6e-20
sonic hedgehog group medulloblastoma -2.400 1.5e-07
atypical teratoid/rhabdoid tumor -2.600 8.3e-12
medulloblastoma, large-cell -2.300 2.2e-05
primitive neuroectodermal tumor -1.400 1.8e-02
adrenocortical carcinoma -1.082 2.0e-02
primary pancreatic ductal adenocarcinoma -1.195 3.4e-03
lung cancer -2.400 1.3e-05
interstitial cystitis -1.300 1.1e-04
pediatric high grade glioma -1.800 2.8e-06
pilocytic astrocytoma -1.100 7.4e-05
Pick disease -1.800 1.8e-03
ductal carcinoma in situ 1.500 1.9e-02
invasive ductal carcinoma 2.100 7.7e-03
ovarian cancer 1.100 1.2e-04
pancreatic cancer -1.100 3.9e-03

Protein-protein Interaction (7)

Gene RIF (30)

PMID Text
25329897 Rap1GAP is ubiquitinated and degraded through proteasome pathway in mitosis. Rap1GAP interacts with PLK1 in vivo.
24642466 kidney biopsies from glomerulosclerosis patients exhibited increased RAP1GAP, resulting in diminished glomerular RAP1 activation
23864657 findings identify Rap1GAP as a critical regulator of aggressive tumor cell behavior and suggest that the level of Rap1GAP expression influences the migratory mechanisms that are operative in tumor cells.
22696507 Downregulation of RAP1GAP in thyroid tumors enhances SRC-dependent signals that regulate cellular architecture and motility.
22614916 Results demonstrated that Rap1GAP promoted leukemia cell differentiation and apoptosis, but increased leukemia cell invasion in vitro.
22266190 Over-expression of Rap1GAP attenuated levels of both cadherins and integrins that are known to regulate the cancer cells invasion in renal cel carcinoma.
21832044 Human kidney cells evidence increased EP4 and decreased Rap1GAP expression levels in the malignant compared with benign samples.
21785277 Rap1GAP is a more effective inhibitor of cell-matrix adhesion compared to cell-cell adhesion.
21633110 These studies establish that the direct physical interaction of Rap1 with KRIT1 enables the translocation of microtubule-sequestered KRIT1 to junctions, thereby supporting junctional integrity and cardiovascular development
21532618 A polycomb-mediated repression of rap1GAP was demonstrated that involves EZH2, a histone methyltransferase in head and neck cancers. It was also shown that the loss of miR-101 expression correlates with EZH2 upregulation and rap1GAP downregulation.
21460216 Ca2+-dependent monomer and dimer formation switches CAPRI Protein between Ras GTPase-activating protein (GAP) and RapGAP activities
20439492 Results suggest that downregulation of Rap1GAP in epithelial tumors where alterations in cell/cell and cell/matrix adhesion are early steps in tumor dissemination supports a role for Rap1GAP depletion in tumor progression.
20124489 Epigenetic or genetic loss of Rap1GAP is very common in thyroid cancer, where these events are sufficient to promote cell proliferation and invasion.
19549374 The expression level of RAP1GAp in myelodysplastic syndrome patients significantly increased as compared with patients with non-malignant blood diseases or AML.
19433443 model in which the Ras GAP-related domain of GAP1(IP4BP) functions to stabilize the switch II region of Rap1, allowing stabilization of the transition state during GTP hydrolysis initiated by the arginine finger
19147557 Overexpression of Rap1GAP in melanoma cells blocks Rap1 activation and extracellular signal-regulated kinase (ERK) phosphorylation and inhibits melanoma cell proliferation and survival.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19066305 a role for Rap1GAP depletion in the progression of human thyroid tumors, possibly through unrestrained Rap activity.
18551404 Data propose that over-expression of RAP1GAP gene may play a role in the pathogenesis of myelodysplastic syndrome.
18483282 Rap1GAP inhibits tumor growth but induces MMP2- and MMP9-mediated SCC invasion and tumor progression, suggesting a role for this protein as a biomarker for early N-stage, aggressive SCCs
17954608 Rap1 increases KRIT-1 targeting to endothelial cell-cell junctions where it suppresses stress fibers and stabilizes junctional integrity.
17646383 Data implicate Rap1GAP as a putative tumor/invasion suppressor in the thyroid, and show that downregulation of Rap1GAP contributes to Ras transformation.
17300802 While Rap1GAP(N290A) is completely inactive on wild-type Rap1, it can act on Rap1(T61Q), arguing that Asn290 in trans has a role in catalysis similar to that of the intrinsic Gln in Ras and Rho.
16436672 Down-regulation of Rap1GAP is associated with oropharyngeal squamous cell carcinoma
16424023 data identify rap1GAP as a putative tumor suppressor gene in pancreatic cancer
15725075 On ephrinB1 stimulation, the small GTPases Rho and Ras are activated and Rap1 is inactivated.
15657046 the G(alpha)o/i-coupled cannabinoid receptor, by regulating the proteasomal degradation of Rap1GAPII, activates Rap1 to induce neurite outgrowth.
14660640 Rap1GAP protein levels are tightly regulated and it may have a role as a tumor suppressor
14607972 Rap1 GTPase has functions in malignancy (review)
12082090 ERK activation by cAMP does not require RAP1

AA Sequence

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETE      1 - 70
PLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHD     71 - 140
VIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEEL    141 - 210
FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQ    211 - 280
QLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLP    281 - 350
DPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN    351 - 420
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKS    421 - 490
GPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAE    491 - 560
ALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR    561 - 630
SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC                                         631 - 663
//

Text Mined References (64)

PMID Year Title
25329897 2014 PLK1 and ?-TrCP-dependent ubiquitination and degradation of Rap1GAP controls cell proliferation.
24642466 2014 Podocyte-specific RAP1GAP expression contributes to focal segmental glomerulosclerosis-associated glomerular injury.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864657 2013 Tumor cell migration and invasion are enhanced by depletion of Rap1 GTPase-activating protein (Rap1GAP).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22696507 2012 RAP1GAP inhibits cytoskeletal remodeling and motility in thyroid cancer cells.
22614916 2012 Rap1GAP alters leukemia cell differentiation, apoptosis and invasion in vitro.
22266190 2012 Rap1GAP regulates renal cell carcinoma invasion.
21832044 2011 Prostaglandin E2 regulates renal cell carcinoma invasion through the EP4 receptor-Rap GTPase signal transduction pathway.
21785277 Rap1GAP impairs cell-matrix adhesion in the absence of effects on cell-cell adhesion.
21633110 2011 A mechanism of Rap1-induced stabilization of endothelial cell--cell junctions.
21532618 2011 The tumor suppressor gene rap1GAP is silenced by miR-101-mediated EZH2 overexpression in invasive squamous cell carcinoma.
21460216 2011 Ca2+-dependent monomer and dimer formation switches CAPRI Protein between Ras GTPase-activating protein (GAP) and RapGAP activities.
20877310 2011 Rap1GAP interacts with RET and suppresses GDNF-induced neurite outgrowth.
20439492 2010 Downregulation of Rap1GAP in human tumor cells alters cell/matrix and cell/cell adhesion.
20124489 2010 Downregulation of Rap1GAP through epigenetic silencing and loss of heterozygosity promotes invasion and progression of thyroid tumors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19549374 2009 Protein RAP1GAP in human myelodysplastic syndrome detected by flow cytometry and its clinical relevance.
19433443 2009 The ability of GAP1IP4BP to function as a Rap1 GTPase-activating protein (GAP) requires its Ras GAP-related domain and an arginine finger rather than an asparagine thumb.
19147557 2009 Down-regulation of Rap1GAP via promoter hypermethylation promotes melanoma cell proliferation, survival, and migration.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19066305 2009 Loss of Rap1GAP in papillary thyroid cancer.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18551404 2008 Expression of Rap1GAP in human myeloid disease following microarray selection.
18483282 2008 Rap1GAP promotes invasion via induction of matrix metalloproteinase 9 secretion, which is associated with poor survival in low N-stage squamous cell carcinoma.
18309292 2008 The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17954608 2007 KRIT-1/CCM1 is a Rap1 effector that regulates endothelial cell cell junctions.
17646383 2007 Downregulation of Rap1GAP contributes to Ras transformation.
17300802 2007 Insight into catalysis of a unique GTPase reaction by a combined biochemical and FTIR approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16436672 2006 Rap1GAP inhibits tumor growth in oropharyngeal squamous cell carcinoma.
16424023 2006 Identification of a putative tumor suppressor gene Rap1GAP in pancreatic cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16076873 2005 Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.
15725075 2005 Down-regulation of Rap1 activity is involved in ephrinB1-induced cell contraction.
15657046 2005 Cannabinoid receptor-induced neurite outgrowth is mediated by Rap1 activation through G(alpha)o/i-triggered proteasomal degradation of Rap1GAPII.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479739 2004 Rap1 promotes cell spreading by localizing Rac guanine nucleotide exchange factors.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15254236 2004 Rap1 regulates the formation of E-cadherin-based cell-cell contacts.
15141215 2004 The GTPase-activating protein Rap1GAP uses a catalytic asparagine.
14660640 2004 Thyroid-stimulating hormone/cAMP and glycogen synthase kinase 3beta elicit opposing effects on Rap1GAP stability.
14607972 2003 Rap1 GTPase: functions, regulation, and malignancy.
12891710 2003 Rap1, a small GTP-binding protein is upregulated during arrest of proliferation in human keratinocytes.
12590145 2003 AF-6 controls integrin-mediated cell adhesion by regulating Rap1 activation through the specific recruitment of Rap1GTP and SPA-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464615 2003 Cyclic AMP-independent involvement of Rap1/B-Raf in the angiotensin II AT2 receptor signaling pathway in NG108-15 cells.
12198116 2002 Activation of Gz attenuates Rap1-mediated differentiation of PC12 cells.
12171996 2002 The small GTPase Rap1 is required for Mn(2+)- and antibody-induced LFA-1- and VLA-4-mediated cell adhesion.
12082090 2002 MAP kinase stimulation by cAMP does not require RAP1 but SRC family kinases.
10593970 1999 Functional interaction between Galpha(z) and Rap1GAP suggests a novel form of cellular cross-talk.
10476970 1999 Activation of the ERK/MAPK pathway by an isoform of rap1GAP associated with G alpha(i)
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
9346962 1997 Human SPA-1 gene product selectively expressed in lymphoid tissues is a specific GTPase-activating protein for Rap1 and Rap2. Segregate expression profiles from a rap1GAP gene product.
8939933 1996 Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.
8275700 1994 The RAP1GA1 locus for human Rap1-GTPase activating protein 1 maps to chromosome 1p36.1-->p35.
1904317 1991 Molecular cloning of a GTPase activating protein specific for the Krev-1 protein p21rap1.
1406653 1992 Localization of the rap1GAP catalytic domain and sites of phosphorylation by mutational analysis.