Property Summary

NCBI Gene PubMed Count 65
PubMed Score 397.47
PubTator Score 68.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 7.9e-09
Disease Target Count Z-score Confidence
Depersonalization disorder 4 3.857 1.9
Cancer 2346 3.235 1.6
Disease Target Count
Kabuki syndrome 29

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 7.9e-09

Gene RIF (31)

PMID Text
26329876 The protein expression of RAP1B and HIF-1 alpha contributed to gastric cancer malignant behavior and poor prognosis.
26209110 Cholera toxin and beta-adrenergic receptor activation phosphorylate Rap1B and inhibit its prenylation and membrane localization.
25569036 Glucocorticoids mediate induction of microRNA-708 to suppress ovarian cancer metastasis through targeting Rap1B.
24790136 Rap1b in both smooth muscle and endothelium plays a key role in maintaining blood pressure by controlling normal vascular tone.
24697700 Hepatitis B virus down-regulated miR-101-3p expression, which resulted in up-regulation of Rap1b, and down-regulation of miR-101-3p or up-regulation of Rap1b promoted proliferation and migration of hepatocellular carcinoma cells
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24573637 TMZ as a standard chemotherapeutic agent for GBM inhibits the Rap1B expression and actin cytoskeleton remodeling to exert its cell killing by upregulating miR-181a/b/c/d subunits
24353183 findings show Rap1b expression decreased significantly in tubules of renal biopsies from patients with diabetic nephropathy (DN); findings indicate Rap1b ameliorates tubular injury and slows progression of DN by modulation of mitochondrial dysfunction via C/EBP-beta-PGC-1alpha signaling
23946483 optimal cell migration is associated with cycles of Rap1 activation, membrane egress, and inactivation, and requires the regulated phosphorylation of Rap1 by PKA
23716716 High concentrations of extracellular adenosine in the tumor microenvironment can chronically activate A2B receptors to suppress Rap1B prenylation and signaling at the cell membrane, resulting in reduced cell-cell contact and promoting cell scattering.
23716715 Adenosine signaling reduces prenylation and plasma membrane localization of Rap1B, resulting in enhanced tumor cell scattering and invasiveness.
23611601 phosphorylation of CalDAG-GEFI is a critical mechanism by which PKA controls Rap1b-dependent platelet aggregation
22958893 miR-518b was down-regulated in esophageal squamous cell carcinoma tissues and correlated with metastasis and survival. Furthermore, Rap1b was revealed to be directly regulated by miR-518b
22642900 miR-139 decreases proliferation by directly targeting RAP1B
19864456 The PTEN-mediated down-regulation of phosphatidylinositol 3-kinase activity may be involved in the regulation of Rap1B-dependent inhibition of Rac1 activity.
19651783 a mechanistic explanation for the differential effects of Rap1 phosphorylation by PKA on effector protein interaction
18948674 RAP1 mutation does not play an important role in papillary thyroid carcinoma pathogenesis.
18948674 Observational study of gene-disease association. (HuGE Navigator)
18842593 Inhibition of PI3K or mTOR reduced the level of Rap1B, which acts downstream of Rheb and mTOR. The ubiquitin E3 ligase Smurf2 mediates the restriction of Rap1B by initiating its degradation.
18805968 Rap1a and Rap1b are essential for the conformational activation of beta1-integrins in endothelial cells
18660803 structure of Epac2 in complex with a cAMP analogue (Sp-cAMPS) and RAP1B by X-ray crystallography and single particle electron microscopy
18625726 Results suggest that Rap1a is a key regulator of fibroblast growth factor 2-induced angiogenesis and together with Rap1b controls endothelial cell functions.
18582561 These results demonstrate that Rap2b, but not the more abundant Rap1b, is associated to lipid rafts in human platelets.
18187620 Knockdown of RAP1B, member of RAS oncogene family (RAP1B) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16357324 Rap1b is an important element in integrin-dependent outside-in signaling during platelet adhesion and regulates the cross talk between adhesive receptors.
16118622 The RAP1B gene mutation is a rare event in myelodysplastic syndromes(MDS) bone marrow cells, in detecting RAP1B mutations, random mutagenesis was performed in RAP1B exons 2 and 3.
15863506 TPO integrates G(i), but not G(q), stimulation, supports integrin alpha(IIb)beta(3) activation platelet aggregation independently of phospholipase C but requires PI3-kinase and Rap1B
15078882 PAR-1 and PAR-4 signal Rap1B activation, the ability of thrombin to activate this GTPase independently of secreted ADP involves costimulation of both receptors as well as binding to GPIb-IX-V.
13679863 RAP1B is prominently expressed in the nucleus of squamous carcinomas.
12407113 Data show that stimulation of a G(i)-dependent signaling pathway causes activation of Rap1B through the action of the PI3K product PtdIns(3,4,5)P(3) and that this process may contribute to potentiation of platelet aggregation.
11994301 Relationships between Rap1b, affinity modulation of integrin alpha IIbbeta 3, and the actin cytoskeleton (integrin alpha(IIb)beta(3))

AA Sequence

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDL      1 - 70
YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN     71 - 140
CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL                              141 - 184
//

Text Mined References (70)

PMID Year Title
26329876 2015 Expression of RAP1B is associated with poor prognosis and promotes an aggressive phenotype in gastric cancer.
26209110 2015 ?-Adrenergic receptors suppress Rap1B prenylation and promote the metastatic phenotype in breast cancer cells.
25569036 2015 Glucocorticoids mediate induction of microRNA-708 to suppress ovarian cancer metastasis through targeting Rap1B.
25416956 2014 A proteome-scale map of the human interactome network.
24790136 2014 Rap1b in smooth muscle and endothelium is required for maintenance of vascular tone and normal blood pressure.
24697700 2014 Functional analysis of miR-101-3p and Rap1b involved in hepatitis B virus-related hepatocellular carcinoma pathogenesis.
24573637 2014 miR-181 subunits enhance the chemosensitivity of temozolomide by Rap1B-mediated cytoskeleton remodeling in glioblastoma cells.
24353183 2014 Rap1 ameliorates renal tubular injury in diabetic nephropathy.
23946483 2013 Protein kinase A-dependent phosphorylation of Rap1 regulates its membrane localization and cell migration.
23716716 2013 An adenosine-mediated signaling pathway suppresses prenylation of the GTPase Rap1B and promotes cell scattering.
23716715 2013 Adenosine promotes tumor metastasis.
23611601 2013 Phosphorylation of CalDAG-GEFI by protein kinase A prevents Rap1b activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
22958893 2012 miR-518b is down-regulated, and involved in cell proliferation and invasion by targeting Rap1b in esophageal squamous cell carcinoma.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22705156 2012 WNT-3a modulates platelet function by regulating small GTPase activity.
22642900 2012 Regulation of RAP1B by miR-139 suppresses human colorectal carcinoma cell proliferation.
22577140 2012 Structural basis for small G protein effector interaction of Ras-related protein 1 (Rap1) and adaptor protein Krev interaction trapped 1 (KRIT1).
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21840392 2011 Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20332120 2010 CCM1 regulates vascular-lumen organization by inducing endothelial polarity.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19864456 2009 Role of Rap1B and tumor suppressor PTEN in the negative regulation of lysophosphatidic acid--induced migration by isoproterenol in glioma cells.
19651783 2009 Phosphorylation-induced conformational changes in Rap1b: allosteric effects on switch domains and effector loop.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18948674 2009 Mutation analysis of RAP1 gene in papillary thyroid carcinomas.
18842593 2008 Rheb and mTOR regulate neuronal polarity through Rap1B.
18805968 2009 Role of the small GTPase Rap1 for integrin activity regulation in endothelial cells and angiogenesis.
18660803 2008 Structure of Epac2 in complex with a cyclic AMP analogue and RAP1B.
18625726 2008 Rap1a is a key regulator of fibroblast growth factor 2-induced angiogenesis and together with Rap1b controls human endothelial cell functions.
18582561 2008 Targeting of the small GTPase Rap2b, but not Rap1b, to lipid rafts is promoted by palmitoylation at Cys176 and Cys177 and is required for efficient protein activation in human platelets.
18309292 2008 The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17509819 2007 Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16581250 2006 p130Cas: a versatile scaffold in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
16357324 2006 The small GTPase Rap1b regulates the cross talk between platelet integrin alpha2beta1 and integrin alphaIIbbeta3.
16118622 2005 Mutation in RAP1 is a rare event in myelodysplastic syndromes.
16005629 2005 Integrins and Src: dynamic duo of adhesion signaling.
15863506 2005 Thrombopoietin complements G(i)- but not G(q)-dependent pathways for integrin {alpha}(IIb){beta}(3) activation and platelet aggregation.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15078882 2004 Contribution of protease-activated receptors 1 and 4 and glycoprotein Ib-IX-V in the G(i)-independent activation of platelet Rap1B by thrombin.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13679863 2003 Rap1A and rap1B ras-family proteins are prominently expressed in the nucleus of squamous carcinomas: nuclear translocation of GTP-bound active form.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407113 2003 A selective role for phosphatidylinositol 3,4,5-trisphosphate in the Gi-dependent activation of platelet Rap1B.
12089143 2002 cAMP inhibition of Akt is mediated by activated and phosphorylated Rap1b.
11994301 2002 Relationships between Rap1b, affinity modulation of integrin alpha IIbbeta 3, and the actin cytoskeleton.
11258948 2001 ADP ribosylation of Arg41 of Rap by ExoS inhibits the ability of Rap to interact with its guanine nucleotide exchange factor, C3G.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9488663 1998 Identification of Nore1 as a potential Ras effector.
8939933 1996 Identification of a novel RalGDS-related protein as a candidate effector for Ras and Rap1.
8524240 1995 Identification of Rap1 as a target for the Crk SH3 domain-binding guanine nucleotide-releasing factor C3G.
8463283 1993 Mutational analysis of the cAMP-dependent protein kinase-mediated phosphorylation site of Rap1b.
7803284 1994 Ultrastructural localization of the small GTP-binding protein Rap1 in human platelets and megakaryocytes.
3141412 1988 Purification and characterization of the 22,000-dalton GTP-binding protein substrate for ADP-ribosylation by botulinum toxin, G22K.
3137530 1988 Nucleotide sequence of a human cDNA encoding a ras-related protein (rap1B).
2123345 1990 Posttranslationally processed structure of the human platelet protein smg p21B: evidence for geranylgeranylation and carboxyl methylation of the C-terminal cysteine.
2108841 1990 Chromosome mapping of the human RAS-related RAP1A, RAP1B, and RAP2 genes to chromosomes 1p12----p13, 12q14, and 13q34, respectively.
2105724 1990 Molecular cloning of smg p21B and identification of smg p21 purified from bovine brain and human platelets as smg p21B.
1696481 1990 Rap1-B is phosphorylated by protein kinase A in intact human platelets.