Property Summary

NCBI Gene PubMed Count 60
PubMed Score 64.02
PubTator Score 66.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.700 2.3e-04
tuberculosis -1.300 5.7e-09
non-small cell lung cancer 1.238 1.6e-13
subependymal giant cell astrocytoma -1.837 4.8e-02
Pick disease -1.100 2.3e-04

Gene RIF (11)

PMID Text
26506250 our results elucidate that RanGAP1 is actively transported between the nuclear and cytoplasmic compartments, and that the cytoplasmic and NPC localization of RanGAP1 is dependent on CRM1-mediated nuclear export.
26321253 immune cell adaptor SLP-76 binds directly to SUMO-RanGAP1 of cytoplasmic fibrils of the nuclear pore complex, and this interaction is needed for optimal NFATc1 and NF-kappaB p65 nuclear entry in T cells
24988324 Differentiation of human coronary artery smooth muscle cell to a contractile phenotype by stepwise serum depletion leads to significant reduction of RanGAP1 protein levels.
22194619 Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
22174317 HIV-1 Rev interacting protein, Ran GTPase activating protein 1 (RANGAP1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21216249 Analysis of the dynamics of E2(Ubc9)-SUMO-Target(RanGAP1) in the absence and presence of E3(RanBP2) revealed that two different allosteric sites regulate the ligase activity.
19454010 HIV-1 Rev interacting protein, Ran GTPase activating protein 1 (RANGAP1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
18706886 The results of this study strengthen the conclusion that mel-18 functions as an anti-SUMO E3 factor, and extend its targets to include regulation of the sumoylation of the important cellular protein RanGAP1.
16428860 RanGAP1 is phosphorylated on Ser-358 in vivo & in vitro. Phosphorylated RanGAP1, but not a mutant at 358S, formed a stable ternary complex with Ran and RanBP1 in vivo, suggesting that its 358S phosphorylation affects the Ran system.
15931224 the 3.0-A crystal structure of a four-protein complex of Ubc9, a Nup358/RanBP2 E3 ligase domain (IR1-M) and SUMO-1 conjugated to the carboxy-terminal domain of RanGAP1
15355965 the RanGAP1 consensus sumoylation site and SUMO-1 C terminus are both conformationally flexible

AA Sequence

MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIA      1 - 70
KALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSA     71 - 140
CFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTL    141 - 210
EEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKG    211 - 280
AVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNM    281 - 350
AKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG    351 - 420
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAV    421 - 490
QDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLL    491 - 560
AFVTKPNSALESCSFARHSLLQTLYKV                                               561 - 587
//

Text Mined References (74)

PMID Year Title
26506250 2015 The Cellular Distribution of RanGAP1 Is Regulated by CRM1-Mediated Nuclear Export in Mammalian Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26321253 2015 The Immune Adaptor SLP-76 Binds to SUMO-RANGAP1 at Nuclear Pore Complex Filaments to Regulate Nuclear Import of Transcription Factors in T Cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24988324 2014 The Ran GTPase-activating protein (RanGAP1) is critically involved in smooth muscle cell differentiation, proliferation and migration following vascular injury: implications for neointima formation and restenosis.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23395904 2013 Ubc9 acetylation modulates distinct SUMO target modification and hypoxia response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22925898 The RanBP2/RanGAP1*SUMO1/Ubc9 complex: a multisubunit E3 ligase at the intersection of sumoylation and the RanGTPase cycle.
22464730 2012 The RanBP2/RanGAP1*SUMO1/Ubc9 complex is a multisubunit SUMO E3 ligase.
22331847 2012 Importin-? negatively regulates multiple aspects of mitosis including RANGAP1 recruitment to kinetochores.
22194619 2012 Determinants of small ubiquitin-like modifier 1 (SUMO1) protein specificity, E3 ligase, and SUMO-RanGAP1 binding activities of nucleoporin RanBP2.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21646468 2011 Effect of ON 01910.Na, an anticancer mitotic inhibitor, on cell-cycle progression correlates with RanGAP1 hyperphosphorylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21216249 2011 Alternative allosteric mechanisms can regulate the substrate and E2 in SUMO conjugation.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19285941 2009 Protection from isopeptidase-mediated deconjugation regulates paralog-selective sumoylation of RanGAP1.
18706886 2008 Mel-18 interacts with RanGAP1 and inhibits its sumoylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18305100 2008 The Nup358-RanGAP complex is required for efficient importin alpha/beta-dependent nuclear import.
18093978 2008 Nuclear tumor necrosis factor receptor-associated factor 6 in lymphoid cells negatively regulates c-Myb-mediated transactivation through small ubiquitin-related modifier-1 modification.
17363900 2007 The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17099698 2006 SUMO protease SENP1 induces isomerization of the scissile peptide bond.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17036045 2006 An extended consensus motif enhances the specificity of substrate modification by SUMO.
17000644 2006 Distinct and overlapping sets of SUMO-1 and SUMO-2 target proteins revealed by quantitative proteomics.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16469311 2006 SUMO modification through rapamycin-mediated heterodimerization reveals a dual role for Ubc9 in targeting RanGAP1 to nuclear pore complexes.
16449645 2006 The mechanism of nuclear export of Smad3 involves exportin 4 and Ran.
16428860 2005 Phosphorylation of RanGAP1 stabilizes its interaction with Ran and RanBP1.
15931224 2005 Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15355965 2004 Structural and dynamic independence of isopeptide-linked RanGAP1 and SUMO-1.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15062103 2004 The RanGAP1-RanBP2 complex is essential for microtubule-kinetochore interactions in vivo.
15037602 2004 RanGAP1*SUMO1 is phosphorylated at the onset of mitosis and remains associated with RanBP2 upon NPC disassembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12192048 2002 Enzymes of the SUMO modification pathway localize to filaments of the nuclear pore complex.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11854305 2002 SUMO-1 targets RanGAP1 to kinetochores and mitotic spindles.
11853669 2002 Structural basis for E2-mediated SUMO conjugation revealed by a complex between ubiquitin-conjugating enzyme Ubc9 and RanGAP1.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11231159 2001 Roles of Ran-GTP and Ran-GDP in precursor vesicle recruitment and fusion during nuclear envelope assembly in a human cell-free system.
10591208 1999 The DNA sequence of human chromosome 22.
10527945 1999 Conserved charged residues in the leucine-rich repeat domain of the Ran GTPase activating protein are required for Ran binding and GTPase activation.
9920803 1999 In vitro SUMO-1 modification requires two enzymatic steps, E1 and E2.
9556629 1998 Characterization of a second member of the sentrin family of ubiquitin-like proteins.
9497385 1998 Modification of Ran GTPase-activating protein by the small ubiquitin-related modifier SUMO-1 requires Ubc9, an E2-type ubiquitin-conjugating enzyme homologue.
9456312 1998 SUMO-1 modification and its role in targeting the Ran GTPase-activating protein, RanGAP1, to the nuclear pore complex.
9442102 1998 Molecular characterization of the SUMO-1 modification of RanGAP1 and its role in nuclear envelope association.
9214382 1997 A novel class of RanGTP binding proteins.
9019411 1997 A small ubiquitin-related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2.
8978815 1996 A novel ubiquitin-like modification modulates the partitioning of the Ran-GTPase-activating protein RanGAP1 between the cytosol and the nuclear pore complex.
8973340 1996 Ubiquitous expression and testis-specific alternative polyadenylation of mRNA for the human Ran GTPase activator RanGAP1.
8896452 1996 Identification of different roles for RanGDP and RanGTP in nuclear protein import.
8146159 1994 RanGAP1 induces GTPase activity of nuclear Ras-related Ran.
7882974 1995 Co-activation of RanGTPase and inhibition of GTP dissociation by Ran-GTP binding protein RanBP1.
7878053 1995 Human RanGTPase-activating protein RanGAP1 is a homologue of yeast Rna1p involved in mRNA processing and transport.
7744835 1995 RNA1 encodes a GTPase-activating protein specific for Gsp1p, the Ran/TC4 homologue of Saccharomyces cerevisiae.