Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.52
PubTator Score 13.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.7e-05
osteosarcoma 7933 5.9e-05
non primary Sjogren syndrome sicca 840 1.9e-02

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.100 1.7e-05
osteosarcoma -1.608 5.9e-05
non primary Sjogren syndrome sicca 1.300 1.9e-02

Gene RIF (7)

PMID Text
26763446 RANBP3 regulates melanoma cell proliferation and probably a potential target for molecular targeted therapy.
23303829 RanBP3 is involved in vRNP nuclear export. The function of RanBP3 during vRNP nuclear export is regulated by phosphorylation at Ser58. RanBP3 phosphorylation is modulated by both PI3K/Akt and Ras/ERK/RSK pathways in the late phase of viral infection.
21364925 Crystal structure of the Ran-binding domain (RBD) from RanBP3 and compare it to RBD structures from RanBP1 and RanBP2 in complex with Ran and CRM1.
19289081 RanBP3 directly recognizes dephosphorylated Smad2/3, which results from the activity of nuclear Smad phosphatases, and mediates nuclear export of Smad2/3 in a Ran-dependent manner.
18280241 RANBP3 phosphorylation links the Ras and PI3-kinase pathways to nucleocytoplasmic transport.
14612415 A multifunctional domain in CRM1 (exportin 1) mediates RanBP3 binding and multimerization of human T-cell leukemia virus type 1 Rex protein.
11932251 RanBP3 stimulates export by enhancing the affinity of Crm1 for Ran-GTP and cargo.

AA Sequence

MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAG      1 - 70
ASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSS     71 - 140
GFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAA    141 - 210
SPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEA    211 - 280
DMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAA    281 - 350
AESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE    351 - 420
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLI    421 - 490
SASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGD    491 - 560
GQTTGST                                                                   561 - 567
//

Text Mined References (34)

PMID Year Title
26763446 2016 RanBP3 Regulates Melanoma Cell Proliferation via Selective Control of Nuclear Export.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23303829 2013 The role of Ran-binding protein 3 during influenza A virus replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21960005 2011 PPM1A dephosphorylates RanBP3 to enable efficient nuclear export of Smad2 and Smad3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364925 2011 Insights into the function of the CRM1 cofactor RanBP3 from the structure of its Ran-binding domain.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19289081 2009 Nuclear export of Smad2 and Smad3 by RanBP3 facilitates termination of TGF-beta signaling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18280241 2008 Ran-binding protein 3 phosphorylation links the Ras and PI3-kinase pathways to nucleocytoplasmic transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612415 2003 A multifunctional domain in human CRM1 (exportin 1) mediates RanBP3 binding and multimerization of human T-cell leukemia virus type 1 Rex protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11932251 2002 Ran-binding protein 3 links Crm1 to the Ran guanine nucleotide exchange factor.
11571268 2001 RanBP3 influences interactions between CRM1 and its nuclear protein export substrates.
11425870 2001 Ran-binding protein 3 is a cofactor for Crm1-mediated nuclear protein export.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
9637251 1998 Human RanBP3, a group of nuclear RanGTP binding proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.