Property Summary

NCBI Gene PubMed Count 202
PubMed Score 303.76
PubTator Score 962.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.083 9.1e-03
Multiple myeloma 1.905 1.7e-04
acute quadriplegic myopathy 1.172 9.0e-06
invasive ductal carcinoma -1.072 5.8e-04
nasopharyngeal carcinoma 1.300 3.9e-05
ovarian cancer -1.500 6.1e-04

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
493048 confirmatory 11 / 0 / 29 RanGTP-Importin-beta complex Measured in Biochemical System Using Plate Reader - 2041-01_Inhibitor_Dose_DryPowder_Activity
540253 confirmatory 242 / 15675 / 325034 qHTS Assay for Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation
540262 summary 0 / 0 / 0 Inhibitors of RanGTP induced Rango (Ran-regulated importin-beta cargo) - Importin beta complex dissociation: Summary

Gene RIF (117)

PMID Text
26725228 RAN is pivotal in linking spatiotemporal control of centrosome regulators to the cell cycle machinery.
26581983 Enterovirus 71-induced downregulation of miR-197 expression increased the expression of RAN, which supported the nuclear transport of the essential viral proteins 3D/3CD and host protein hnRNP K for viral replication.
26481147 Data show that RNA-binding protein LIN28B coordinates the expression of the oncogene RAN protein and aurora A kinase (AURKA) in neuroblastoma.
26438829 Elevated metaphase RanGTP levels use Ubr5 to couple overall chromosome congression to SAC silencing.
26272610 comparison of the GTPase reaction of the slower hydrolyzing GTPase Ran with Ras
26147304 Variations in RAN rs14035of Korean patients are significantly associated with their risk of colorectal cancer.
26056081 FGF2 nuclear translocation is regulated by Karyopherin-beta2 and Ran GTPase in human glioblastoma cells
25894517 Inter-cellular transport of ran GTPase
25748139 Data show that importin-beta (impbeta) alters the nuclear pore's permeability in a Ran-dependent manner, suggesting that impbeta is a functional component of the nuclear pore complex (NPC).
25723178 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
25564443 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
25486595 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
25486594 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
25452301 stress can disrupt the Ran gradients through RCC1-dependent and RCC1-independent mechanisms
25444926 Ran silencing did not affect the A375 invasive capability, while it was enhanced in 526 cells, suggesting that Ran knockdown, by AurkA down-regulation, resulted in a Ran-independent enhanced melanoma cell invasion.
25348717 PI3Kbeta regulates the nuclear envelope through upstream regulation of RCC1 and Ran
25331866 based on the new structures suggests LM phosphorylation status may mediate Ran's selection of exportin(s) and cargo(s), perverting these native trafficking elements into the lethal antihost Nup phosphorylation pathways.
24915079 Towards understanding its molecular mechanism, a 2.9 A resolution crystal structure of human TRN-SR2 complexed with the small GTPase Ran has been determined
24769857 Association between recurrent pregnancy loss development and the polymorphism of the miRNA machinery gene RAN and combined genotype of DROSHA/DICER.
24625450 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 have roles in serous epithelial ovarian cancer
24530126 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
24523287 reducing the nuclear concentration of Ran is sufficient to induce reactive oxygen species irrespective of progerin.
24076388 Overexpressed Ran in pancreatic cancer tissues was found highly correlated with the histological grade. Downregulation of Ran led to significant suppression of cell proliferation, cell cycle arrest at the G1/S phase and induction of apoptosis.
24001611 MiR-203 may act as novel tumor suppressor in esophageal cancer through down-regulating the expression of Ran and miR-21.
23878195 a model wherein one monomer of TRN-SR2 is bound to one monomer of RanGTP.
23878195 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
23868705 Polymorphism in RAN gene is associated with HBV-related hepatocellular carcinoma
23783028 our data suggest a model for mitotic spindle positioning in which RanGTP and CLASP1 cooperate to align the spindle along the long axis of the dividing cell.
23711384 Therefore, the Encephalomyocarditis virus leader protein:Ran GTPase binding, mediated by the linker-hinge, is a required step in the leader protein-induced nuclear transport inhibition.
23536659 RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
23468463 Results suggest that Ran is required for and is a potential therapeutic target of Myc-driven cancer progression in both breast and lung cancers.
23444224 Data show that five genes CKAP5, KPNB1, RAN, TPX2 and KIF11 were shown to be essential for tumor cell survival in both head and neck squamous cell carcinoma (HNSCC)and non-small cell lung cancer (NSCLC), but most particularly in HNSCC.
23311631 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
23308199 Reduced RAN expression and disrupted transport between cytoplasm and nucleus are the key events in Alzheimer's disease pathophysiology.
23160023 Reduction in Ran levels causes cytoplasmic decrease and nuclear accumulation of importin alpha leading to cellular senescence in normal cells.
23125841 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
23118896 RanBPM loss of expression results in constitutive activation of the ERK pathway and promotes cellular events leading to cellular transformation and tumorigenesis.
23097435 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
22956174 Our findings emphasize the important role of Ran in differentiation, disease stage, and metastasis in human colorectal cancer
22783232 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
22679017 a novel connection between the hyper-activation of the small GTPase Ran and the matricellular protein SMOC-2 that has important consequences for oncogenic transformation.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22355797 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
22174317 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
22114719 Loss of ran GTP-Binding Protein is associated with overt diabetes, with hyperglycemia, reduced insulin production, and nearly complete loss of islet number and islet mass.
22090358 Overexpression of Ran in clinical specimens is significantly associated with poor patient outcome in both breast and lung cancers.
22081094 MCRS1 is a RanGTP-regulated factor essential for non-centrosomal microtubule assembly.
21998203 Ran GTP plays key role in ciliogenesis and ciliary protein transport.
21813642 in vitro and in vivo phosphorylation of RanBP1 by Plk1 as well as the importance of phosphorylation of RanBP1 in the interaction between Plk1 and Ran during early mitosis, is demonstrated.
21692748 RanGTP may play an important role in specifying that spindle assembly occurs around chromosomes
21670151 the cellular effects of progerin expression in Hutchinson-Gilford progeria syndrome are transduced, at least in part, through reduced function of the Ran GTPase and E2 SUMOylation pathways
21630149 [review] The cellular functions of Ran are mediated by RanGTP interactions with nuclear transport receptors related to importin beta and depend on the existence of chromosome-centered RanGTP gradient.
21625522 study defines importin-alpha/importin-beta1/Ran as the molecular mechanism by which STAT3 traffics to the nucleus
21364925 Crystal structure of the Ran-binding domain (RBD) from RanBP3 and compare it to RBD structures from RanBP1 and RanBP2 in complex with Ran and CRM1.
21358275 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
21195711 Data suggest actin accumulation in senescent cells is due to the failure of RanGTP restoration with ATP deficiency and NTF2 accumulation, resulting in decreased actin export via Exp6 inactivation.
21033436 The increased expression of Ran in lung squamous cell carcinoma might be correlated with carcinogenesis.
20942967 Data show that downregulation of Ran expression in aggressive ovarian cancer cell lines affects cellular proliferation by inducing a caspase-3 associated apoptosis.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20658144 Downregulation of the Ran GTPase effector RanBP1 is required for nuclear reorganisation.
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20547757 Ran-GTP and Epac1 interact with each other in vivo and in vitro. This binding requires a previously uncharacterized Ras association domain in Epac1.
20081840 Data show that Nup107-160 promotes spindle assembly through Ran-GTP-regulated nucleation of microtubules by gamma-TuRC at kinetochores, and reveal a relationship between nucleoporins and the microtubule cytoskeleton.
20028979 Activation of the Ran GTPase is subject to growth factor regulation and can give rise to cellular transformation.
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19765287 Ran-GTP generated at chromatin is highly mobile and interacts dynamically with distal structures that are involved in nuclear transport and mitotic spindle assembly.
19753112 the small GTPase RAN is a novel MAD2B binding protein
19559616 RAN GTPase is a RASSF1A effector involved in controlling microtubule organization.
19549784 Data show that the interaction between Ran-GDP and importin-beta promotes the dissociation of GDP from Ran. The release of GDP from the Ran-GDP-importin-beta complex stabilizes the complex, which cannot be dissociated by importin-alpha.
19454010 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
19435463 Data show that ARHI could compete for Ran-importin binding and induce disruption of importin-binding to cargo proteins, including STAT3.
19389996 study presents the crystal structure of the SPN1.CRM1.RanGTP export complex at 2.5 angstrom resolution (where SPN1 is snurportin1 and RanGTP is guanosine 5' triphosphate-bound Ran
19208764 Data provide a molecular explanation for the assembly of the apoptotic microtubule network, and suggest important similarities with the process of RanGTP- and TPX2-mediated mitotic spindle formation.
19149559 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19060893 Therefore, we propose that RCC1 reads the histone code created by caspase-activated Mst1 to initiate apoptosis by reducing the level of RanGTP in the nucleus.
19047128 Observational study of gene-disease association. (HuGE Navigator)
18845677 reduction of the affinity by RanGTP really occurs at the nucleoplasmic side of the entire nuclear pore complex
18708071 Data show the crystal structure of the Kap95p-RanGDP complex shows that Kap95p induces the switch I and II regions of RanGDP to adopt a conformation that resembles that of the GTP-bound form.
18690538 These results suggest that Ran suppresses paclitaxel-induced cell death through the downregulation of JNK-mediated signal pathways.
18617507 Ran is a novel negative regulator of nuclear VRK1 and VRK2 kinase activity, which may vary in different subcellular localizations generating an asymmetric intracellular distribution of kinase activity depending on local protein interactions.
18591255 Survivin is a novel effector of Ran signaling, and this pathway may be preferentially exploited for spindle assembly in tumor cells.
18565325 These data demonstrate that ARA24/Ran increases AR transactivation by enhancing the androgen receptor N-C interaction in the nucleus.
18508616 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
18347012 RanBP10 might serve as a molecular link between Ran and noncentrosomal microtubules
18287525 The complex of RanGTP, the export receptor Crm1, and nuclear export signal-bearing proteins regulates microtubule nucleation at kinetochores.
18268099 Ran-GTP-mediated cargo release promotes the accumulation of hKid on chromosomes.
18266911 Results report that NTF2 and Ran control nuclear import of the filamentous actin capping protein CapG.
18241036 High expression of Ran GTPase is associated with local invasion and metastasis of human clear cell renal cell carcinoma
18205094 Observational study of gene-disease association. (HuGE Navigator)
18003734 A cell-free import assay showed that the nuclear transport of the human herpesvirus 6 U69 protein was mediated by importin alpha/beta in conjunction with the small GTPase Ran.
17761537 Ran system is a target of hyperosmotic stress signaling, and cells use protein localization-based mechanisms as part of a rapid stress response
17671426 developed a spatial model that allowed the simulation of RanGTP production with different degrees of chromosome alignment in mitosis
17426026 studies elucidate the Ran-binding interface on Nup153 and, more broadly, provide insight into the versatility of this zinc finger binding module
16930555 Plk1 regulates the spindle organization partially through its phosphorylation on Ran
16807353 Multiple nuclear exclusion motifs and a nuclear localization domain control PTEN nuclear localization by a Ran-dependent mechanism and suggest a proapoptotic role for PTEN in the cell nucleus.
16572426 High level of Ran appears to be more tightly associated with a poor prognosis.
16572176 results demonstrate that conserved Ran-regulated pathways are involved in multiple, parallel processes required for spindle function, but that their relative contribution differs in chromatin- versus centrosome/kinetochore-driven spindle assembly systems
16449645 Exportin 4 is sufficient for carrying the in vitro nuclear export of Smad3 in cooperation with Ran.
16428860 Phosphorylated wild type RanGAP1, but not a mutant harboring a mutation at the phosphorylation site 358S, efficiently formed a stable ternary complex with Ran and RanBP1 in vivo, suggesting that the 358S phosphorylation of RanGAP1 affects the Ran system.
16368437 Findings indicate that the decrease in ATP levels induced by cellular stress causes a decrease in RanGTP levels and a collapse of Ran distribution in the cytoplasmic and nuclear compartments.
16294017 Review proposes that Ran/Crm1 may act as a 'loading dock' to coordinate various checkpoint factors in regulating the fidelity of centrosome duplication during cell cycle progression.
15691838 Keratin sequestration of oxidized Ran may provide a back-up protective mechanism in some cases of oxidative injury
15632149 nuclear import of the transcription factor PU.1 occurs via RanGTP-stimulated binding to Nup153
15014043 the cell-cycle machinery directly regulates the Ran-signaling pathway by placing a high RanGTP concentration on the mitotic chromosome; RCC1 to couples RanGTP production to chromosome binding
14675621 data suggest that HPV16 E7 translocates through the nuclear pores via a nonclassical Ran-dependent pathway, independent of the main cytosolic Kap beta import receptors
14600264 Ran modulates at least two processes involved in spindle assembly
14585972 structure of the Ran-RanBP1-RanGAP complex
12415012 chromosomal interactions during meiosis and mitosis
12134013 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
12051861 C terminus of Ran is a major determinant of the state of Ran, and that removal of this allows the GDP-bound form to adopt a GTP-like conformation, thereby creating a constitutively active protein.
11779226 GTP-binding proteins G(salpha), G(ialpha), and Ran identified in mitochondria of human placenta
10518602 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
9837918 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA
9562972 the GTP bound form of Ran (RanGTP) binds to a preformed Rev-CRM1 (exportin 1) complex to mediate nuclear export of HIV-1 mRNA

AA Sequence

MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQE      1 - 70
KFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHR     71 - 140
KKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALP    141 - 210
DEDDDL                                                                    211 - 216
//

Text Mined References (212)

PMID Year Title
26725228 2016 The GTPase RAN regulates multiple steps of the centrosome life cycle.
26581983 2015 Host MicroRNA miR-197 Plays a Negative Regulatory Role in the Enterovirus 71 Infectious Cycle by Targeting the RAN Protein.
26481147 2015 A LIN28B-RAN-AURKA Signaling Network Promotes Neuroblastoma Tumorigenesis.
26438829 2015 RanGTP aids anaphase entry through Ubr5-mediated protein turnover.
26272610 2015 Catalysis of GTP hydrolysis by small GTPases at atomic detail by integration of X-ray crystallography, experimental, and theoretical IR spectroscopy.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
26056081 2015 Nuclear translocation of fibroblast growth factor-2 (FGF2) is regulated by Karyopherin-?2 and Ran GTPase in human glioblastoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894517 2015 Inter-cellular transport of ran GTPase.
25748139 2015 Importin-? modulates the permeability of the nuclear pore complex in a Ran-dependent manner.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25452301 2015 Disruption of the ran system by cysteine oxidation of the nucleotide exchange factor RCC1.
25444926 2015 Ran signaling in melanoma: implications for the development of alternative therapeutic strategies.
25416956 2014 A proteome-scale map of the human interactome network.
25348717 2015 Phosphoinositide 3-kinase beta protects nuclear envelope integrity by controlling RCC1 localization and Ran activity.
25331866 2014 Solution structures of Mengovirus Leader protein, its phosphorylated derivatives, and in complex with nuclear transport regulatory protein, RanGTPase.
24915079 2014 Structure of transportin SR2, a karyopherin involved in human disease, in complex with Ran.
24855949 2014 A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway.
24769857 2014 Genetic variants in microRNA machinery genes are associated [corrected] with idiopathic recurrent pregnancy loss risk.
24625450 2014 RAN nucleo-cytoplasmic transport and mitotic spindle assembly partners XPO7 and TPX2 are new prognostic biomarkers in serous epithelial ovarian cancer.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
24523287 2014 A pathway linking oxidative stress and the Ran GTPase system in progeria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076388 2013 Ran GTPase protein promotes human pancreatic cancer proliferation by deregulating the expression of Survivin and cell cycle proteins.
24001611 2014 MiR-203 suppresses tumor growth and invasion and down-regulates MiR-21 expression through repressing Ran in esophageal cancer.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23878195 2013 Interaction of transportin-SR2 with Ras-related nuclear protein (Ran) GTPase.
23868705 2013 Potentially functional genetic variants in microRNA processing genes and risk of HBV-related hepatocellular carcinoma.
23783028 2013 RanGTP and CLASP1 cooperate to position the mitotic spindle.
23711384 2013 Encephalomyocarditis virus Leader protein hinge domain is responsible for interactions with Ran GTPase.
23536659 2013 Guanine-nucleotide exchange factor RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
23468463 2013 RanGTPase: a candidate for Myc-mediated cancer progression.
23444224 2013 Functional genetic screens identify genes essential for tumor cell survival in head and neck and lung cancer.
23435562 2013 Structural basis for the nuclear export activity of Importin13.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23311631 2013 Thioredoxin-like protein 2 is overexpressed in colon cancer and promotes cancer cell metastasis by interaction with ran.
23308199 2013 Reduced RAN expression and disrupted transport between cytoplasm and nucleus; a key event in Alzheimer's disease pathophysiology.
23251006 2013 Impairment of glioma stem cell survival and growth by a novel inhibitor for Survivin-Ran protein complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160023 2013 Downregulation of the small GTPase ras-related nuclear protein accelerates cellular ageing.
23118896 2012 RanBPM is an inhibitor of ERK signaling.
22956174 2013 High Ran level is correlated with poor prognosis in patients with colorectal cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22679017 2012 Characterization of a novel activated Ran GTPase mutant and its ability to induce cellular transformation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22114719 2011 Essential role of the small GTPase Ran in postnatal pancreatic islet development.
22090358 2012 Ran is a potential therapeutic target for cancer cells with molecular changes associated with activation of the PI3K/Akt/mTORC1 and Ras/MEK/ERK pathways.
22081094 2011 K-fibre minus ends are stabilized by a RanGTP-dependent mechanism essential for functional spindle assembly.
21998203 2011 Induction of Ran GTP drives ciliogenesis.
21813642 2011 Phosphorylation of Ran-binding protein-1 by Polo-like kinase-1 is required for interaction with Ran and early mitotic progression.
21692748 2011 The site of RanGTP generation can act as an organizational cue for mitotic microtubules.
21670151 2011 The defective nuclear lamina in Hutchinson-gilford progeria syndrome disrupts the nucleocytoplasmic Ran gradient and inhibits nuclear localization of Ubc9.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21630149 2011 The role of RanGTP gradient in vertebrate oocyte maturation.
21625522 2011 Dynamics of the STAT3 transcription factor: nuclear import dependent on Ran and importin-?1.
21364925 2011 Insights into the function of the CRM1 cofactor RanBP3 from the structure of its Ran-binding domain.
21269460 2011 Initial characterization of the human central proteome.
21195711 2011 Reduction of exportin 6 activity leads to actin accumulation via failure of RanGTP restoration and NTF2 sequestration in the nuclei of senescent cells.
21139563 2011 Structure of Importin13-Ubc9 complex: nuclear import and release of a key regulator of sumoylation.
21033436 2010 [Expression and clinical significance of Ran in lung squamous carcinoma tissues].
20951941 2010 A genetic defect in exportin-5 traps precursor microRNAs in the nucleus of cancer cells.
20942967 2010 An essential role for Ran GTPase in epithelial ovarian cancer cell survival.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20658144 2010 Nuclear reformation after mitosis requires downregulation of the Ran GTPase effector RanBP1 in mammalian cells.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20547757 2010 The interaction of Epac1 and Ran promotes Rap1 activation at the nuclear envelope.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20081840 2010 The Nup107-160 complex and gamma-TuRC regulate microtubule polymerization at kinetochores.
20028979 2010 Activation of the Ran GTPase is subject to growth factor regulation and can give rise to cellular transformation.
19946888 2010 Defining the membrane proteome of NK cells.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19765287 2009 Dynamic localisation of Ran GTPase during the cell cycle.
19753112 2009 The mitotic arrest deficient protein MAD2B interacts with the small GTPase RAN throughout the cell cycle.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19559616 2009 RAN GTPase is a RASSF1A effector involved in controlling microtubule organization.
19549784 2009 Importin-beta is a GDP-to-GTP exchange factor of Ran: implications for the mechanism of nuclear import.
19435463 2009 ARHI (DIRAS3), an imprinted tumour suppressor gene, binds to importins and blocks nuclear import of cargo proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19389996 2009 Crystal structure of the nuclear export receptor CRM1 in complex with Snurportin1 and RanGTP.
19208764 2009 Dynamic release of nuclear RanGTP triggers TPX2-dependent microtubule assembly during the apoptotic execution phase.
19166812 2009 The actin-capping protein CapG localizes to microtubule-dependent organelles during the cell cycle.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19060893 2009 Apoptotic histone modification inhibits nuclear transport by regulating RCC1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18938132 2008 The F-actin filament capping protein CapG is a bona fide nucleolar protein.
18845677 2008 Individual binding pockets of importin-beta for FG-nucleoporins have different binding properties and different sensitivities to RanGTP.
18708071 2008 Kap95p binding induces the switch loops of RanGDP to adopt the GTP-bound conformation: implications for nuclear import complex assembly dynamics.
18691641 2008 Nuclear localization of a novel human syntaxin 1B isoform.
18690538 2008 Ran suppresses paclitaxel-induced apoptosis in human glioblastoma cells.
18617507 2008 Proteomics identification of nuclear Ran GTPase as an inhibitor of human VRK1 and VRK2 (vaccinia-related kinase) activities.
18591255 2008 A survivin-ran complex regulates spindle formation in tumor cells.
18565325 2008 ARA24/Ran enhances the androgen-dependent NH2- and COOH-terminal interaction of the androgen receptor.
18347012 2008 RanBP10 is a cytoplasmic guanine nucleotide exchange factor that modulates noncentrosomal microtubules.
18287525 2008 Localized RanGTP accumulation promotes microtubule nucleation at kinetochores in somatic mammalian cells.
18268099 2008 Importin-beta and the small guanosine triphosphatase Ran mediate chromosome loading of the human chromokinesin Kid.
18266911 2008 A new role for nuclear transport factor 2 and Ran: nuclear import of CapG.
18241036 2008 High expression of Ran GTPase is associated with local invasion and metastasis of human clear cell renal cell carcinoma.
18205094 2007 Genetic polymorphisms of the renin-angiotensin system in preterm delivery and premature rupture of membranes.
18003734 2008 Characterization of the human herpesvirus 6 U69 gene product and identification of its nuclear localization signal.
17761537 2007 Hyperosmotic stress signaling to the nucleus disrupts the Ran gradient and the production of RanGTP.
17671426 2007 Coordination of chromosome alignment and mitotic progression by the chromosome-based Ran signal.
17426026 2007 Molecular characterization of the Ran-binding zinc finger domain of Nup153.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16930555 2006 Polo-like kinase 1-mediated phosphorylation of the GTP-binding protein Ran is important for bipolar spindle formation.
16807353 2006 Nuclear localization of PTEN by a Ran-dependent mechanism enhances apoptosis: Involvement of an N-terminal nuclear localization domain and multiple nuclear exclusion motifs.
16572426 2006 Tissue array analysis of expression microarray candidates identifies markers associated with tumor grade and outcome in serous epithelial ovarian cancer.
16572176 2006 Analysis of a RanGTP-regulated gradient in mitotic somatic cells.
16449645 2006 The mechanism of nuclear export of Smad3 involves exportin 4 and Ran.
16428860 2005 Phosphorylation of RanGAP1 stabilizes its interaction with Ran and RanBP1.
16368437 2006 Mechanism of the stress-induced collapse of the Ran distribution.
16294017 2005 Loading and unloading: orchestrating centrosome duplication and spindle assembly by Ran/Crm1.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15691838 2005 Human Ran cysteine 112 oxidation by pervanadate regulates its binding to keratins.
15635413 2005 Nucleolar proteome dynamics.
15632149 2005 Carrier-independent nuclear import of the transcription factor PU.1 via RanGTP-stimulated binding to Nup153.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15574332 2004 PHAX and CRM1 are required sequentially to transport U3 snoRNA to nucleoli.
15574331 2004 Architecture of CRM1/Exportin1 suggests how cooperativity is achieved during formation of a nuclear export complex.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15014043 2004 Phosphorylation of RCC1 in mitosis is essential for producing a high RanGTP concentration on chromosomes and for spindle assembly in mammalian cells.
14758368 2004 Contribution of noncentrosomal microtubules to spindle assembly in Drosophila spermatocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684163 2004 A novel MET-interacting protein shares high sequence similarity with RanBPM, but fails to stimulate MET-induced Ras/Erk signaling.
14681208 2003 Exportin-5 mediates the nuclear export of pre-microRNAs and short hairpin RNAs.
14675621 2003 The E7 oncoprotein of high-risk human papillomavirus type 16 enters the nucleus via a nonclassical Ran-dependent pathway.
14612415 2003 A multifunctional domain in human CRM1 (exportin 1) mediates RanBP3 binding and multimerization of human T-cell leukemia virus type 1 Rex protein.
14600264 2003 Ran modulates spindle assembly by regulating a subset of TPX2 and Kid activities including Aurora A activation.
14585972 2003 Biochemical characterization of the Ran-RanBP1-RanGAP system: are RanBP proteins and the acidic tail of RanGAP required for the Ran-RanGAP GTPase reaction?
14500717 2003 Serine/threonine kinase Mirk/Dyrk1B is an inhibitor of epithelial cell migration and is negatively regulated by the Met adaptor Ran-binding protein M.
12808100 2003 Hydrogen peroxide triggers nuclear export of telomerase reverse transcriptase via Src kinase family-dependent phosphorylation of tyrosine 707.
12773398 2003 Coordinated nuclear export of 60S ribosomal subunits and NMD3 in vertebrates.
12649209 2003 E1A deregulates the centrosome cycle in a Ran GTPase-dependent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12415012 2002 Chromosomal association of Ran during meiotic and mitotic divisions.
12384575 2002 Karyopherin beta 2B participates in mRNA export from the nucleus.
12211070 2002 Ran, a GTP-binding protein involved in nucleocytoplasmic transport and microtubule nucleation, relocates from the manchette to the centrosome region during rat spermiogenesis.
12194828 2002 Targeting of RCC1 to chromosomes is required for proper mitotic spindle assembly in human cells.
12176322 2002 Npap60/Nup50 is a tri-stable switch that stimulates importin-alpha:beta-mediated nuclear protein import.
12138183 2002 Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains.
12101123 2002 Nercc1, a mammalian NIMA-family kinase, binds the Ran GTPase and regulates mitotic progression.
11932251 2002 Ran-binding protein 3 links Crm1 to the Ran guanine nucleotide exchange factor.
11832950 2002 RanGAP mediates GTP hydrolysis without an arginine finger.
11809816 2002 Ribosomal protein L12 uses a distinct nuclear import pathway mediated by importin 11.
11779226 2002 GTP-binding proteins G(salpha), G(ialpha), and Ran identified in mitochondria of human placenta.
11777942 2002 Exportin-5, a novel karyopherin, mediates nuclear export of double-stranded RNA binding proteins.
11774384 2002 Characterization and potential function of a novel testis-specific nucleoporin BS-63.
11571268 2001 RanBP3 influences interactions between CRM1 and its nuclear protein export substrates.
11447110 2001 Importin 13: a novel mediator of nuclear import and export.
11425870 2001 Ran-binding protein 3 is a cofactor for Crm1-mediated nuclear protein export.
11420673 2001 Specific association of Type I c-Abl with Ran GTPase in lipopolysaccharide-mediated differentiation.
11336674 2001 Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation (RCC1).
11310559 2001 Identification of nuclear-import and cell-cycle regulatory proteins that bind to prothymosin alpha.
11290418 2001 Identification and characterization of the human MOG1 gene.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.
10944119 2000 Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes.
10786834 2000 PHAX, a mediator of U snRNA nuclear export whose activity is regulated by phosphorylation.
10779340 2000 Facilitated nucleocytoplasmic shuttling of the Ran binding protein RanBP1.
10679025 2000 Monoclonal antibodies to NTF2 inhibit nuclear protein import by preventing nuclear translocation of the GTPase Ran.
10567585 1999 Identification of an NTF2-related factor that binds Ran-GTP and regulates nuclear protein export.
10518602 1999 Rev-mediated nuclear export of RNA is dominant over nuclear retention and is coupled to the Ran-GTPase cycle.
10408446 1999 Generation of GTP-bound Ran by RCC1 is required for chromatin-induced mitotic spindle formation.
10400640 1999 The linkage of Kennedy's neuron disease to ARA24, the first identified androgen receptor polyglutamine region-associated coactivator.
10397761 1999 Nuclear import of sterol regulatory element-binding protein-2, a basic helix-loop-helix-leucine zipper (bHLH-Zip)-containing transcription factor, occurs through the direct interaction of importin beta with HLH-Zip.
10394366 1999 The crystal structure of rna1p: a new fold for a GTPase-activating protein.
10369786 1999 Model of the ran-RCC1 interaction using biochemical and docking experiments.
10353245 1999 Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
10318915 1999 Two distinct classes of Ran-binding sites on the nucleoporin Nup-358.
10209022 1999 CRM1-mediated recycling of snurportin 1 to the cytoplasm.
10202161 1999 Nup153 is an M9-containing mobile nucleoporin with a novel Ran-binding domain.
10078529 1999 Structure of a Ran-binding domain complexed with Ran bound to a GTP analogue: implications for nuclear transport.
10037787 1999 A monoclonal antibody to the COOH-terminal acidic portion of Ran inhibits both the recycling of Ran and nuclear protein import in living cells.
10022920 1999 Identification of a new Pyk2 target protein with Arf-GAP activity.
9837918 1998 The specificity of the CRM1-Rev nuclear export signal interaction is mediated by RanGTP.
9822603 1998 NTF2 mediates nuclear import of Ran.
9817760 1998 When overexpressed, a novel centrosomal protein, RanBPM, causes ectopic microtubule nucleation similar to gamma-tubulin.
9802899 1998 Identification of darlin, a Dictyostelium protein with Armadillo-like repeats that binds to small GTPases and is important for the proper aggregation of developing cells.
9660920 1998 Identification of a tRNA-specific nuclear export receptor.
9637251 1998 Human RanBP3, a group of nuclear RanGTP binding proteins.
9562972 1998 HIV-1 nuclear import: matrix protein is back on center stage, this time together with Vpr.
9533885 1998 Structural basis for molecular recognition between nuclear transport factor 2 (NTF2) and the GDP-bound form of the Ras-family GTPase Ran.
9405152 1997 Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta.
9368653 1997 Nuclear protein import is decreased by engineered mutants of nuclear transport factor 2 (NTF2) that do not bind GDP-Ran.
9323134 1997 Export of importin alpha from the nucleus is mediated by a specific nuclear transport factor.
9323133 1997 CRM1 is an export receptor for leucine-rich nuclear export signals.
9219684 1997 The Ras-RasGAP complex: structural basis for GTPase activation and its loss in oncogenic Ras mutants.
9214382 1997 A novel class of RanGTP binding proteins.
9135132 1997 Dominant-negative mutants of importin-beta block multiple pathways of import and export through the nuclear pore complex.
9114010 1997 Cloning and characterization of human karyopherin beta3.
9045717 1997 Different binding domains for Ran-GTP and Ran-GDP/RanBP1 on nuclear import factor p97.
8757804 1996 The 1.6 angstroms resolution crystal structure of nuclear transport factor 2 (NTF2).
8692944 1996 Nuclear protein import: Ran-GTP dissociates the karyopherin alphabeta heterodimer by displacing alpha from an overlapping binding site on beta.
8643389 1995 A candidate gene for RNA export carrier protein has two RBDs (RNA binding domain and Ran binding domain).
8576188 1996 Ran binding domains promote the interaction of Ran with p97/beta-karyopherin, linking the docking and translocation steps of nuclear import.
8421051 1993 Ran/TC4: a small nuclear GTP-binding protein that regulates DNA synthesis.
7891706 1995 Separate domains of the Ran GTPase interact with different factors to regulate nuclear protein import and RNA processing.
7885480 1995 Crystal structure of the nuclear Ras-related protein Ran in its GDP-bound form.
7878053 1995 Human RanGTPase-activating protein RanGAP1 is a homologue of yeast Rna1p involved in mRNA processing and transport.
7744835 1995 RNA1 encodes a GTPase-activating protein specific for Gsp1p, the Ran/TC4 homologue of Saccharomyces cerevisiae.
7603572 1995 A giant nucleopore protein that binds Ran/TC4.
2108320 1990 Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line.
1961752 1991 Mitotic regulator protein RCC1 is complexed with a nuclear ras-related polypeptide.
1855255 1991 Premature initiation of mitosis in yeast lacking RCC1 or an interacting GTPase.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.