Property Summary

NCBI Gene PubMed Count 46
PubMed Score 44.43
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (19)

PMID Text
24831942 the AM system is widely expressed in human thymus from newborns; both AM1 receptor components CLR and RAMP2, but not RAMP3, are not associated with the plasma membrane of TECs and thymocytes but are located intracellularly, notably in the nucleus
24199627 Data suggest isoforms of RAMP modulate accessibility of peptides to residues situated on CALCRL (calcitonin receptor-like receptor) N-terminal domain; RAMP3/RAMP2/RAMP1 appear to alter accessibility of specific residues at CALCRL-RAMP interface.
24169318 The expression of RAMP3 is downregulated in the fetal lung with increasing gestational age.
22445753 the RAMP3 TMD participates in the negative regulation of CLR/RAMP3 internalization.
20802105 Data show that LOXL2 and RAMP3 are strongly coexpressed in human colon, breast, and gastric carcinomas but not in normal colon or gastric epithelial cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20034525 This study provides insight into the role of three amino acid changes in human RAMP3.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19886671 Morphological fluorescence techniques, bioluminescence resonance energy transfer, and bimolecular fluorescence complementation analysis demonstrate that the secretin receptor associates specifically with RAMP3, but not with RAMP1 or RAMP2.
18835256 The His residues of hRAMP2 and -3 differentially govern adrenomedullin receptor function.
18593822 Identification of RAMP3 residues for adrenomedjullin receptors are reported.
16912219 This study reveals important functionality of the RAMP C-terminal domain and identifies key differences in the role of the RAMP C terminus for calcitonin receptor versus calcitonin receptor-like receptor-based receptors.
16410241 the respective C-tails of hRAMP2 and -3 differentially affect hCRLR surface delivery and internalization
15805108 results, using both endogenous and overexpressed cellular models, indicate a novel function for NHERF-1 and RAMP3 in the internalization of the adrenomedullin receptor and suggest additional regulatory mechanisms for receptor trafficking
15613468 RAMP3 interacts with N-ethylmaleimide-sensitive factor to cause the change in trafficking
15300632 Data found that expressions of RAMP1, RAMP2 and RAMP3 mRNAs increased with the worsening of heart function, but the expressions of RAMP1 and RAMP2 mRNA decreased at level IV of heart failure.
12565884 Co-expression of calcitonin receptors (CT) lacking a portion of domain 1 with receptor activity-modifying protein (RAMP) 1, 2, or 3 appears to produce functional CT-(8-32)-sensitive adrenomedullin receptors.
11973435 results show the presence of calcitonin receptor-like receptor and receptor activity-modifying proteins in middle meningeal, middle cerebral, pial, and superficial temporal vessels
11693189 Receptor activity modifying proteins interaction with human and porcine calcitonin receptor-like receptor (CRLR) in HEK-293 cells

AA Sequence

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFT      1 - 70
NCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWR     71 - 140
SKRTDTLL                                                                  141 - 148
//

Text Mined References (46)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24831942 2014 Expression and distribution of the adrenomedullin system in newborn human thymus.
24199627 2014 Receptor activity-modifying protein-dependent effects of mutations in the calcitonin receptor-like receptor: implications for adrenomedullin and calcitonin gene-related peptide pharmacology.
24169318 2014 Adrenomedullin expression in the developing human fetal lung.
23674134 2013 G-protein-coupled receptor 30 interacts with receptor activity-modifying protein 3 and confers sex-dependent cardioprotection.
22445753 2012 Characterization of the single transmembrane domain of human receptor activity-modifying protein 3 in adrenomedullin receptor internalization.
20802105 2011 Receptor activity modifying protein-3 mediates the protumorigenic activity of lysyl oxidase-like protein-2.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20034525 2010 Functional characterization of two human receptor activity-modifying protein 3 variants.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19886671 2009 Molecular basis of association of receptor activity-modifying protein 3 with the family B G protein-coupled secretin receptor.
18835256 2008 Functions of the extracellular histidine residues of receptor activity-modifying proteins vary within adrenomedullin receptors.
18593822 2008 Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16912219 2006 A critical role for the short intracellular C terminus in receptor activity-modifying protein function.
16410241 2006 Functions of the cytoplasmic tails of the human receptor activity-modifying protein components of calcitonin gene-related peptide and adrenomedullin receptors.
15805108 2005 Receptor activity-modifying protein (RAMP) isoform-specific regulation of adrenomedullin receptor trafficking by NHERF-1.
15613468 2005 Novel function for receptor activity-modifying proteins (RAMPs) in post-endocytic receptor trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15300632 2004 [Increased atria expression of receptor activity-modifying proteins in heart failure patients].
14722252 2004 Characterization of the human calcitonin gene-related peptide receptor subtypes associated with receptor activity-modifying proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615490 2004 Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes.
12939163 2003 N-Glycosylation and conserved cysteine residues in RAMP3 play a critical role for the functional expression of CRLR/RAMP3 adrenomedullin receptor.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12565884 2003 Novel calcitonin-(8-32)-sensitive adrenomedullin receptors derived from co-expression of calcitonin receptor with receptor activity-modifying proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446722 2003 Novel receptor partners and function of receptor activity-modifying proteins.
12419522 2002 Paracrine/autocrine function of adrenomedullin in peripheral nerves of rats.
12093471 2002 Molecular cloning and pharmacological characterization of bovine calcitonin receptor-like receptor from bovine aortic endothelial cells.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11973435 2002 Immunohistochemical localization of calcitonin receptor-like receptor and receptor activity-modifying proteins in the human cerebral vasculature.
11693189 2001 Receptor activity modifying proteins interaction with human and porcine calcitonin receptor-like receptor (CRLR) in HEK-293 cells.
11591721 2001 The seven amino acids of human RAMP2 (86) and RAMP3 (59) are critical for agonist binding to human adrenomedullin receptors.
11387328 2001 Protein-protein interaction and not glycosylation determines the binding selectivity of heterodimers between the calcitonin receptor-like receptor and the receptor activity-modifying proteins.
11060459 2000 Genomic structure and chromosome mapping of human and mouse RAMP genes.
10882736 2000 Visualization of the calcitonin receptor-like receptor and its receptor activity-modifying proteins during internalization and recycling.
10385705 1999 Multiple amylin receptors arise from receptor activity-modifying protein interaction with the calcitonin receptor gene product.
10354609 1999 RAMPs: accessory proteins for seven transmembrane domain receptors.
9620797 1998 RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.