Property Summary

Ligand Count 1
NCBI Gene PubMed Count 48
PubMed Score 46.23
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (20)

AA Sequence

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFT      1 - 70
NCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWR     71 - 140
SKRTDTLL                                                                  141 - 148
//

Text Mined References (48)

PMID Year Title