Property Summary

NCBI Gene PubMed Count 43
PubMed Score 76.39
PubTator Score 45.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis 1.040 1.1e-03
psoriasis -1.300 1.4e-03
medulloblastoma 2.000 1.5e-05
glioblastoma 1.700 4.4e-05
medulloblastoma, large-cell 2.000 2.0e-05
primitive neuroectodermal tumor 1.800 4.9e-05
non-small cell lung carcinoma -2.100 8.9e-37
lung cancer -2.800 2.8e-06
lung adenocarcinoma -1.600 1.6e-17
lung carcinoma -1.700 7.6e-09
invasive ductal carcinoma -1.300 3.3e-03

Gene RIF (22)

PMID Text
26198634 This study reveals the glucagon receptor as a previously unidentified target for GLP-1 receptor agonists and highlights a role for RAMP2 in regulating its pharmacology.
25982113 Data suggest that ligand binding of a G protein-coupled receptor (GPCR) may inform drug development targeting calcitonin receptor-like receptor (CLR):receptor activity-modifying proteins RAMP1/2 complexes.
24831942 the AM system is widely expressed in human thymus from newborns; both AM1 receptor components CLR and RAMP2, but not RAMP3, are not associated with the plasma membrane of TECs and thymocytes but are located intracellularly, notably in the nucleus
24505304 Adrenomedullin-RAMP2 system suppresses ER stress-induced tubule cell death and is involved in kidney protection.
24199627 Data suggest isoforms of RAMP modulate accessibility of peptides to residues situated on CALCRL (calcitonin receptor-like receptor) N-terminal domain; RAMP3/RAMP2/RAMP1 appear to alter accessibility of specific residues at CALCRL-RAMP interface.
24169318 RAMP2 gene expression increases with gestational age development in the fetal lung.
22102369 The CRLR-RAMP2 interactions were confirmed for the full-length proteins on the cell surface by site-specific photo-crosslinking.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20074556 the hCRLR C-tail is crucial for adrenomedullin-evoked cAMP production and internalization of the CRLR/RAMP2, while the receptor internalization is dependent on the aforementioned GPCR kinases, but not Gs coupling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19210874 findings provided no significant linkage or association of adrenomedullin and CRLR-RAMP-2 genes with rheumatoid arthritis in the studied trio families
19210874 Observational study of gene-disease association. (HuGE Navigator)
18835256 The His residues of hRAMP2 and -3 differentially govern adrenomedullin receptor function.
18593822 Identification of RAMP2 residues for adrenomedullin receptors are reported.
17671114 RAMP2 is silenced by promoter hypermethylation in lung cancer
16912219 This study reveals important functionality of the RAMP C-terminal domain and identifies key differences in the role of the RAMP C terminus for calcitonin receptor versus calcitonin receptor-like receptor-based receptors.
16410241 the respective C-tails of hRAMP2 and -3 differentially affect hCRLR surface delivery and internalization
15613468 adrenomedullin receptors are comprised of RAMP2 and calcitonin receptor-like receptor.
15300632 Data found that expressions of RAMP1, RAMP2 and RAMP3 mRNAs increased with the worsening of heart function, but the expressions of RAMP1 and RAMP2 mRNA decreased at level IV of heart failure.
15245870 TNF-alpha induced time- and dose-dependent decreases in the expression of RAMP2 mRNA in cultured human coronary artery smooth muscle cells , thereby diminishing AM-evoked cAMP production
12565884 Co-expression of calcitonin receptors (CT) lacking a portion of domain 1 with receptor activity-modifying protein (RAMP) 1, 2, or 3 appears to produce functional CT-(8-32)-sensitive adrenomedullin receptors.
11973435 results show the presence of calcitonin receptor-like receptor and receptor activity-modifying proteins in middle meningeal, middle cerebral, pial, and superficial temporal vessels

AA Sequence

MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWN      1 - 70
HYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSD     71 - 140
PPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA                                       141 - 175
//

Text Mined References (44)

PMID Year Title
26198634 2015 Modulation of Glucagon Receptor Pharmacology by Receptor Activity-modifying Protein-2 (RAMP2).
25982113 2015 Structural Basis for Receptor Activity-Modifying Protein-Dependent Selective Peptide Recognition by a G Protein-Coupled Receptor.
24831942 2014 Expression and distribution of the adrenomedullin system in newborn human thymus.
24505304 2014 Adrenomedullin-RAMP2 system suppresses ER stress-induced tubule cell death and is involved in kidney protection.
24199627 2014 Receptor activity-modifying protein-dependent effects of mutations in the calcitonin receptor-like receptor: implications for adrenomedullin and calcitonin gene-related peptide pharmacology.
24169318 2014 Adrenomedullin expression in the developing human fetal lung.
22102369 2012 Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596610 2010 Involvement of vascular endothelial growth factor signaling in CLR/RAMP1 and CLR/RAMP2-mediated pro-angiogenic effect of intermedin on human vascular endothelial cells.
20074556 2010 Function of the cytoplasmic tail of human calcitonin receptor-like receptor in complex with receptor activity-modifying protein 2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19210874 Lack of linkage and association of adrenomedullin and its receptor genes in French Caucasian rheumatoid arthritis trio families.
18835256 2008 Functions of the extracellular histidine residues of receptor activity-modifying proteins vary within adrenomedullin receptors.
18593822 2008 Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18097473 2008 The GPCR modulator protein RAMP2 is essential for angiogenesis and vascular integrity.
17671114 2007 Frequent inactivation of RAMP2, EFEMP1 and Dutt1 in lung cancer by promoter hypermethylation.
16964401 2006 Gene silencing of human RAMP2 mediated by short-interfering RNA.
16912219 2006 A critical role for the short intracellular C terminus in receptor activity-modifying protein function.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16531504 2006 Distinct receptor activity-modifying protein domains differentially modulate interaction with calcitonin receptors.
16410241 2006 Functions of the cytoplasmic tails of the human receptor activity-modifying protein components of calcitonin gene-related peptide and adrenomedullin receptors.
15613468 2005 Novel function for receptor activity-modifying proteins (RAMPs) in post-endocytic receptor trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300632 2004 [Increased atria expression of receptor activity-modifying proteins in heart failure patients].
15245870 2004 Tumor necrosis factor-alpha downregulates adrenomedullin receptors in human coronary artery smooth muscle cells.
14722252 2004 Characterization of the human calcitonin gene-related peptide receptor subtypes associated with receptor activity-modifying proteins.
12565884 2003 Novel calcitonin-(8-32)-sensitive adrenomedullin receptors derived from co-expression of calcitonin receptor with receptor activity-modifying proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446722 2003 Novel receptor partners and function of receptor activity-modifying proteins.
12419522 2002 Paracrine/autocrine function of adrenomedullin in peripheral nerves of rats.
12093471 2002 Molecular cloning and pharmacological characterization of bovine calcitonin receptor-like receptor from bovine aortic endothelial cells.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11973435 2002 Immunohistochemical localization of calcitonin receptor-like receptor and receptor activity-modifying proteins in the human cerebral vasculature.
11754963 2001 The role of the CGRP-receptor component protein (RCP) in adrenomedullin receptor signal transduction.
11591721 2001 The seven amino acids of human RAMP2 (86) and RAMP3 (59) are critical for agonist binding to human adrenomedullin receptors.
11387328 2001 Protein-protein interaction and not glycosylation determines the binding selectivity of heterodimers between the calcitonin receptor-like receptor and the receptor activity-modifying proteins.
11060459 2000 Genomic structure and chromosome mapping of human and mouse RAMP genes.
10882736 2000 Visualization of the calcitonin receptor-like receptor and its receptor activity-modifying proteins during internalization and recycling.
10767413 2000 Mammalian calcitonin receptor-like receptor/receptor activity modifying protein complexes define calcitonin gene-related peptide and adrenomedullin receptors in Drosophila Schneider 2 cells.
10354609 1999 RAMPs: accessory proteins for seven transmembrane domain receptors.
10217420 1999 The RAMP2/CRLR complex is a functional adrenomedullin receptor in human endothelial and vascular smooth muscle cells.
9620797 1998 RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor.