Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.70
PubTator Score 3.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.721 3.2e-03
adult high grade glioma -3.200 6.9e-06
astrocytic glioma -2.700 1.1e-03
Astrocytoma, Pilocytic -2.500 2.1e-05
atypical teratoid / rhabdoid tumor -4.700 2.0e-08
colon cancer -2.600 5.9e-07
ependymoma -3.300 2.1e-03
glioblastoma -3.300 3.9e-08
intraductal papillary-mucinous carcinoma... -1.400 5.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
lung carcinoma 1.600 1.2e-13
medulloblastoma -1.600 2.6e-02
medulloblastoma, large-cell -4.000 4.0e-06
nephrosclerosis -1.409 3.7e-03
oligodendroglioma -2.300 2.2e-02
pituitary cancer -2.500 2.7e-02
primitive neuroectodermal tumor -3.600 3.6e-03
psoriasis -1.300 1.5e-03
severe Alzheimer's disease -1.179 3.3e-02
subependymal giant cell astrocytoma -2.217 4.9e-02

Synonym

Accession Q86SE5 B3KTH2 G3V129 Q6ZW87 Q8N1C2 hRALYL
Symbols HNRPCL3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARA      1 - 70
AVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLF     71 - 140
DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKI    141 - 210
DSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDE    211 - 280
DGGHELFLQIK                                                               281 - 291
//

Text Mined References (14)

PMID Year Title