Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.67
PubTator Score 3.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis -1.409 3.7e-03
astrocytoma -2.900 3.0e-03
posterior fossa group A ependymoma -4.400 5.4e-16
oligodendroglioma -2.300 2.2e-02
glioblastoma -3.900 3.8e-06
sonic hedgehog group medulloblastoma -3.000 8.7e-05
atypical teratoid / rhabdoid tumor -4.700 2.0e-08
medulloblastoma, large-cell -4.000 4.0e-06
primitive neuroectodermal tumor -3.600 3.6e-03
adrenocortical carcinoma -2.721 3.2e-03
intraductal papillary-mucinous carcinoma... -1.400 5.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
colon cancer -2.600 5.9e-07
pediatric high grade glioma -3.300 3.7e-07
pilocytic astrocytoma -2.600 2.2e-05
subependymal giant cell astrocytoma -2.217 4.9e-02
severe Alzheimer's disease -1.179 3.3e-02
lung carcinoma 1.600 1.2e-13
pituitary cancer -2.500 2.7e-02
psoriasis -1.300 1.5e-03

AA Sequence

MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARA      1 - 70
AVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLF     71 - 140
DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKI    141 - 210
DSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDE    211 - 280
DGGHELFLQIK                                                               281 - 291
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12688537 2003 A novel cDNA encodes a putative hRALY-like protein, hRALYL.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.