Property Summary

NCBI Gene PubMed Count 60
PubMed Score 100.75
PubTator Score 92.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (39)

PMID Text
26406496 RLIP76 expression is induced by TNF-alpha and follows the induction kinetics of inflammation markers, suggesting that inflammation can influence RLIP76 expression at the blood brain barrier.
26125275 report showed that RLIP76 expression was significantly increased in breast cancer samples and positively correlated with the malignant status of breast cancer patients; results indicated that high RLIP76 expression was associated with poor prognosis of breast cancer patients
26067553 results revealed that the effect of miR-101 on prostate cancer cell apoptosis was due to RLIP76 regulation of the PI3K/Akt/Bcl-2 signaling pathway
25993541 High RLIP76 expression is associated with a poor outcome of meningioma.
25213293 RLIP76 downregulation in HT29 CRC cells suppressed cell growth, enhanced cell apoptosis, induced cell cycle arrest, and inhibited cell invasion by decreasing MMP2 expression.
24839008 RLIP76 is a potential target for developing novel therapeutic strategies for leukemia
24450627 RLIP76 is a node for Rho and Ras family signalling. [Review]
23576547 Activation of RalBP1 during neoplastic epithelial cell transformation induces cytoplasmic accumulation of p27, this event requires p27 Ser-10 phosphorylation by protein kinase B/Akt.
23419874 p300 associates with the RLIP76 promoter via an overlapping cMYB and cETS binding site and regulates RLIP76 promoter activity and its expression.
23276796 RLIP76 may suppress apoptosis and promote the proliferation of glioma cells by direct adenosine triphosphate-dependent xenobiotic transport and by activating the Rac1-JNK signaling pathway.
22549157 RalBP1 protein is an independent predictor of poor survival and early relapse for CRC patients
22331470 RalB-mediated invadopodium formation was dependent on RalBP1/RLIP76; disruption of the ATPase function of RalBP1 impaired invadopodium formation.
21822277 Data show that disrupting either RALA or RALBP1 leads to a loss of mitochondrial fission at mitosis, improper segregation of mitochondria during cytokinesis and a decrease in ATP levels and cell number.
21671802 The impairment of RLIP76 by aaRLIP76 can play a role in the damage of vascular cells from females, contributing to the gender-associated pathogenesis of immune-mediated vascular diseases.
21170262 studies suggest that the expression of RalBP1 is necessary for human cancer cell metastasis; show that the requirement for RalA expression for manifestation of this phenotype is not entirely dependent on a RalA-RalBP1 interaction
20183533 a link between RLIP76 mediated GS-E transport and cell cycle signaling are presented.
19626587 Studies offer strong support for the hypothesis that RLIP76 is an overarching anti-apoptosis mechanism that, if inhibited, can be more broadly effective in the treatment of renal cell carcinoma.
19417134 RLIP76 is an anticancer for kidney cancer: inhibition of RLIP76 function by antibody or its depletion by small interfering RNA or antisense DNA causes marked regression of kidney xenografts in nude mice.
19375851 the accumulation-deficient drug-resistance mediated by RLIP76 can be modulated by inhibition of RLIP76 transport activity by cdc2.
19073149 RLIP76 serves a key effector function for survival of prostate cancer cells; depletion of RLIP76 in mice bearing xenografts of prostate cancer cells leads to near complete regression of established subcutaneous xenografts with no apparent toxic effects.
18976975 Knockdown of ralA binding protein 1 (RALBP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18628450 RLIP76 is a fundamental link between biochemical pathways and glutathione-linked metabolism of xenobiotics and stress-degense signaling pathways.
18474607 Hsf-1 causes specific and saturable inhibition of the transport activity of Ralbp1 and that the combination of Hsf-1 and POB1 causes nearly complete inhibition through specific bindings with Ralbp1.
18086001 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18086001 common variants in RLIP76 are unlikely to contribute to epilepsy drug response.
17993611 autoantibodies to RLIP76 play a pathogenetic role in immune-mediated vascular diseases
17982077 the spatiotemporal mobilization of TICAM-1 in response to dsRNA and the formation of the TICAM-1 speckles containing RIP1 and NAP1 are important for the activation of the TLR3-TICAM-1 pathway.
17706599 phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76)
17047155 identify a role for caspase-8 in monocytes undergoing macrophagic differentiation, that is, the enzyme activated in an atypical complex down-regulates NF-kappaB activity through RIP1 cleavage.
16890208 Augmenting cellular levels of RLIP76 using purified recombinant RLIP76 increased growth rate in all cells, and restored the sensitivity of RLIP76-/- mouse embryonic fibroblasts to both inhibition through PKCalpha-depletion and stimulation through PMA.
16188027 RLIP76 is the predominant transporter of antiepileptic drugs in the blood brain barrier and may be involved in mechanisms of drug-resistant epilepsy.
16087181 Results identify targets in RLIP76 for phosphorylation by protein kinase C alpha, which may act as substrates for differential transport of doxorubicin.
15707977 These results show for the first time that POB1 can regulate the transport function of RLIP76 and are consistent with our previous studies showing that inhibition of RLIP76 induces apoptosis in cancer cells.
12775724 RLIP/RalBP1 is used as a platform by the mitotic cdk1 to facilitate the phosphorylation of Epsin, which makes Epsin incompetent for endocytosis during mitosis, when endocytosis is switched off.
12632061 RLIP76 has a role in triggering apoptosis in lung cancer cells and synergistically increaseing doxorubicin cytotoxicity
12632060 RLIP76 has a role in Doxorubicin transport in lung cancer
12527936 RLIP76 activity is a general determinant of 4HNE and DOX resistance. Its activity contributes to the drug-resistant phenotype of NSCLC.
12433796 In this review, RLIP76-mediated transport of organic ions has physiological and toxicological relevance which may play an important role in the mechanism of drug resistance.
11732624 We have compared the transport properties of recombinant RLIP76 and human erythrocyte membrane RLIP76.

AA Sequence

MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGK      1 - 70
KKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEK     71 - 140
HKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLP    141 - 210
AVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLT    211 - 280
KELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV    281 - 350
QISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI    351 - 420
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEIL    421 - 490
TEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQ    491 - 560
RQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKA    561 - 630
AKEQPKAGKEPAKPSPSRDRKETSI                                                 631 - 655
//

Text Mined References (71)

PMID Year Title
26406496 2015 Inflammation Modulates RLIP76/RALBP1 Electrophile-Glutathione Conjugate Transporter and Housekeeping Genes in Human Blood-Brain Barrier Endothelial Cells.
26125275 2015 RLIP76 expression as a prognostic marker of breast cancer.
26067553 2015 RLIP76-dependent suppression of PI3K/AKT/Bcl-2 pathway by miR-101 induces apoptosis in prostate cancer.
25993541 2015 Overexpression of RLIP76 Required for Proliferation in Meningioma Is Associated with Recurrence.
25416956 2014 A proteome-scale map of the human interactome network.
25213293 2015 RLIP76 blockade by siRNA inhibits proliferation, enhances apoptosis, and suppresses invasion in HT29 colon cancer cells.
24839008 2014 Knockdown of RLIP76 expression by RNA interference inhibits proliferation, enhances apoptosis, and increases chemosensitivity to daunorubicin in U937 leukemia cells.
24450627 2014 Structure and function of RLIP76 (RalBP1): an intersection point between Ras and Rho signalling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23576547 2013 Dual effects of Ral-activated pathways on p27 localization and TGF-? signaling.
23419874 2013 P300 regulates the human RLIP76 promoter activity and gene expression.
23276796 2013 RLIP76 is overexpressed in human glioblastomas and is required for proliferation, tumorigenesis and suppression of apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22549157 2012 Overexpression of RalBP1 in colorectal cancer is an independent predictor of poor survival and early tumor relapse.
22331470 2012 The RalB small GTPase mediates formation of invadopodia through a GTPase-activating protein-independent function of the RalBP1/RLIP76 effector.
21822277 2011 RALA and RALBP1 regulate mitochondrial fission at mitosis.
21671802 2011 Gender disparity in susceptibility to oxidative stress and apoptosis induced by autoantibodies specific to RLIP76 in vascular cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21170262 2010 RalBP1 is necessary for metastasis of human cancer cell lines.
20709745 2010 The epsin family of endocytic adaptors promotes fibrosarcoma migration and invasion.
20696399 2010 The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction.
20183533 2009 Physiological and pharmacological significance of glutathione-conjugate transport.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19626587 2010 Rlip76 transports sunitinib and sorafenib and mediates drug resistance in kidney cancer.
19417134 2009 RLIP76: a target for kidney cancer therapy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19375851 2009 Increased expression of cdc2 inhibits transport function of RLIP76 and promotes apoptosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19073149 2009 Regression of prostate cancer xenografts by RLIP76 depletion.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628450 2008 RLIP76 and Cancer.
18474607 2008 Hsf-1 and POB1 induce drug sensitivity and apoptosis by inhibiting Ralbp1.
18239685 2008 Inflammatory cardiac valvulitis in TAX1BP1-deficient mice through selective NF-kappaB activation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
18086001 2007 The association between polymorphisms in RLIP76 and drug response in epilepsy.
17993611 2008 Autoantibodies to the C-terminal subunit of RLIP76 induce oxidative stress and endothelial cell apoptosis in immune-mediated vascular diseases and atherosclerosis.
17982077 2007 Spatiotemporal mobilization of Toll/IL-1 receptor domain-containing adaptor molecule-1 in response to dsRNA.
17706599 2007 Mass spectroscopic phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76).
17703191 2007 Essential role for TAX1BP1 in the termination of TNF-alpha-, IL-1- and LPS-mediated NF-kappaB and JNK signaling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17047155 2007 Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation.
16890208 2006 Mitogenic and drug-resistance mediating effects of PKCalpha require RLIP76.
16227629 2005 Molecular determinants of kinase pathway activation by Apo2 ligand/tumor necrosis factor-related apoptosis-inducing ligand.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16188027 2005 RLIP76, a non-ABC transporter, and drug resistance in epilepsy.
16087181 2005 The role of PKCalpha and RLIP76 in transport-mediated doxorubicin-resistance in lung cancer.
15707977 2005 POB1 over-expression inhibits RLIP76-mediated transport of glutathione-conjugates, drugs and promotes apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451561 2004 Novel factors in regulation of activin signaling.
15310755 2004 AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation.
12888294 2003 Ral-GTPases: approaching their 15 minutes of fame.
12775724 2003 RLIP, an effector of the Ral GTPases, is a platform for Cdk1 to phosphorylate epsin during the switch off of endocytosis in mitosis.
12632061 2003 Role of RLIP76 in lung cancer doxorubicin resistance: III. Anti-RLIP76 antibodies trigger apoptosis in lung cancer cells and synergistically increase doxorubicin cytotoxicity.
12632060 2003 Role of RLIP76 in lung cancer doxorubicin resistance: II. Doxorubicin transport in lung cancer by RLIP76.
12527936 2003 Role of RLIP76 in lung cancer doxorubicin resistance: I. The ATPase activity of RLIP76 correlates with doxorubicin and 4-hydroxynonenal resistance in lung cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433796 2002 RLIP76, a novel transporter catalyzing ATP-dependent efflux of xenobiotics.
11882656 2002 Regulation of endocytosis of activin type II receptors by a novel PDZ protein through Ral/Ral-binding protein 1-dependent pathway.
11437348 2001 RLIP76 is the major ATP-dependent transporter of glutathione-conjugates and doxorubicin in human erythrocytes.
10924126 2000 Novel function of human RLIP76: ATP-dependent transport of glutathione conjugates and doxorubicin.
10910768 2000 RLIP76, an effector of the GTPase Ral, interacts with the AP2 complex: involvement of the Ral pathway in receptor endocytosis.
10848592 2000 Involvement of Ras and Ral in chemotactic migration of skeletal myoblasts.
9753634 1998 Identification and characterization in Xenopus of XsmgGDS, a RalB binding protein.
9422736 1998 Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of Ral.
9395447 1997 An Eps homology (EH) domain protein that binds to the Ral-GTPase target, RalBP1.
8570186 1995 A putative effector of Ral has homology to Rho/Rac GTPase activating proteins.
7673236 1995 Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.