Property Summary

NCBI Gene PubMed Count 44
PubMed Score 49.70
PubTator Score 46.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 3.247 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.400 1.3e-02
malignant mesothelioma -1.100 5.4e-05
astrocytic glioma -1.300 9.7e-03
ependymoma -1.100 4.3e-02
psoriasis 2.600 3.1e-05
osteosarcoma 2.549 3.5e-07
medulloblastoma, large-cell -1.700 2.5e-04
group 4 medulloblastoma -1.300 1.7e-04

Protein-protein Interaction (11)

Gene RIF (30)

PMID Text
26216878 striking isoform-specific consequences of distinct CAAX-signaled posttranslational modifications that contribute to the divergent subcellular localization and activity of RalA and RalB.
25573158 These findings suggest that RalB might be one of the targets for facilitating the invasive phenotype of malignant gliomas induced by GGTase-I.
25210032 expression of K-Ras and RalB and possibly RalA proteins is critical for maintaining low levels of p53, and down-regulation of these GTPases reactivates p53 by significantly enhancing its stability, contributing to suppression of malignant transformation
24747441 Integrin alpha(v)beta expression and the resulting KRAS-RalB-NF-kappaB pathway were both necessary and sufficient for tumour initiation, anchorage independence, self-renewal and erlotinib resistance.
24389431 High RALB mRNA expression is associated with non-small-cell lung cancer growth and progression.
24056301 nutrient starvation induces RALB deubiquitylation by accumulation and relocalization of the deubiquitylase USP33 to RALB-positive vesicles
23830877 RalA and RalB exhibit both distinct and redundant roles in tumorigenesis (Review).
22790202 The study found upregulated RalA and RalB activation in colorectal cancer tumor cell lines and tumors.
22700969 the existence of an ubiquitination/de-ubiquitination cycle superimposed on the GDP/GTP cycle of RalA, involved in the regulation of RalA activity as well as in membrane raft trafficking.
22393054 phosphorylation by PKCalpha is critical for RalB-mediated vesicle trafficking and exocytosis.
22331470 a novel RalB-mediated biochemical and signaling mechanism for invadopodium formation
22013078 RalA and RalB differentially regulate development of epithelial tight junctions.
21810610 Our results identify a role for RalA and RalB in cell-mediated cytotoxicity
21241894 Study finds that the Ras-like small G protein, RalB, is localized to nascent autophagosomes and is activated on nutrient deprivation.
20940393 Non-phosphorylated RalB is associated with bladder cancer cell growth and metastasis.
20801877 Rgl2 and RalB both localized to the leading edge, and this localization of RalB was dependent on endogenous Rgl2 expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19636851 1H, 13C and 15N resonance assignments for the small G protein RalB in its active conformation. Backbone amide dynamics parameters for a majority of residues have also been obtained
19306925 These results establish RalA and GRK2 as key regulators of LPA receptor signalling and demonstrate for the first time that LPA(1) activity facilitates the formation of a novel protein complex between these two proteins.
19166349 Backbone dynamics and the structure of free RalB bound to the GTP analogue GMPPNP were determined using NMR spectroscopy.
18976975 Knockdown of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein; RALB) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18756269 RalA and RalB support mitotic progression through mobilization of the exocyst for two spatially and kinetically distinct steps of cytokinesis
18227351 RalB was found to mediate SDF-1-induced migration
17875936 Data suggest that RalA and RalB are important, functionally distinct targets for GGTI-mediated tumor apoptosis and growth inhibition.
17709381 These data extend understanding of the functional roles of the Ral pathway and begin to identify signaling pathways relevant for organ-specific metastasis.
17606711 analysis of activation and differential expression of RalA and RalB in human bladder cancer
17174914 study concludes RalA function is critical to tumor initiation, while RalB is more important for tumor metastasis in the tested pancreatic carcinoma cell lines & argues for critical roles of Ral proteins during progression of Ras-driven pancreatic cancers
17018283 These observations define the mechanistic contribution of RalGTPases to cancer cell survival and reveal the RalB/Sec5 effector complex as a component of TBK1-dependent innate immune signaling.
12856001 RALA and RALB collaborate to maintain tumorigenicity through regulation of both proliferation and survival; RALB is specifically required for survival of tumour cells but not normal cells
12034722 differential binding of calmodulin by RalA and RalB

AA Sequence

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA      1 - 70
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV     71 - 140
EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL        141 - 206
//

Text Mined References (49)

PMID Year Title
26216878 2015 Divergent roles of CAAX motif-signaled posttranslational modifications in the regulation and subcellular localization of Ral GTPases.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25573158 2015 Involvement of RalB in the effect of geranylgeranyltransferase I on glioma cell migration and invasion.
25210032 2014 Ral GTPase down-regulation stabilizes and reactivates p53 to inhibit malignant transformation.
24747441 2014 An integrin ??-KRAS-RalB complex drives tumour stemness and resistance to EGFR inhibition.
24389431 2013 Contributions of KRAS and RAL in non-small-cell lung cancer growth and progression.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23830877 2013 Ral GTPases in tumorigenesis: emerging from the shadows.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22790202 Differential involvement of RalA and RalB in colorectal cancer.
22700969 2012 RalA and RalB proteins are ubiquitinated GTPases, and ubiquitinated RalA increases lipid raft exposure at the plasma membrane.
22393054 2012 Phosphorylation by protein kinase C? regulates RalB small GTPase protein activation, subcellular localization, and effector utilization.
22331470 2012 The RalB small GTPase mediates formation of invadopodia through a GTPase-activating protein-independent function of the RalBP1/RLIP76 effector.
22013078 2011 RalA and RalB differentially regulate development of epithelial tight junctions.
21810610 2011 Ral GTPases regulate cell-mediated cytotoxicity in NK cells.
21269460 2011 Initial characterization of the human central proteome.
21241894 2011 RalB and the exocyst mediate the cellular starvation response by direct activation of autophagosome assembly.
20940393 2010 Phosphorylation of RalB is important for bladder cancer cell growth and metastasis.
20801877 2010 Aberrant overexpression of the Rgl2 Ral small GTPase-specific guanine nucleotide exchange factor promotes pancreatic cancer growth through Ral-dependent and Ral-independent mechanisms.
20696399 2010 The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19636851 2007 1H, 13C and 15N resonance assignments for the small G protein RalB in its active conformation.
19306925 2009 Dual regulation of lysophosphatidic acid (LPA1) receptor signalling by Ral and GRK.
19166349 2009 Solution structure and dynamics of the small GTPase RalB in its active conformation: significance for effector protein binding.
18756269 2008 Distinct roles of RalA and RalB in the progression of cytokinesis are supported by distinct RalGEFs.
18227351 2008 The small GTPase Ral mediates SDF-1-induced migration of B cells and multiple myeloma cells.
17875936 2007 Geranylgeranyltransferase I inhibitors target RalB to inhibit anchorage-dependent growth and induce apoptosis and RalA to inhibit anchorage-independent growth.
17709381 2007 Activation of the RalGEF/Ral pathway promotes prostate cancer metastasis to bone.
17606711 2007 Expression of ral GTPases, their effectors, and activators in human bladder cancer.
17174914 2006 Divergent roles for RalA and RalB in malignant growth of human pancreatic carcinoma cells.
17018283 2006 RalB GTPase-mediated activation of the IkappaB family kinase TBK1 couples innate immune signaling to tumor cell survival.
15817490 2005 Regulation of phospholipase C-delta1 through direct interactions with the small GTPase Ral and calmodulin.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525976 2003 Ral GTPases regulate exocyst assembly through dual subunit interactions.
12874025 2003 rgr oncogene: activation by elimination of translational controls and mislocalization.
12856001 2003 RAL GTPases are linchpin modulators of human tumour-cell proliferation and survival.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12034722 2002 Calmodulin binds RalA and RalB and is required for the thrombin-induced activation of Ral in human platelets.
11744922 2002 The exocyst complex binds the small GTPase RalA to mediate filopodia formation.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
9422736 1998 Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of Ral.
9297626 1997 Ras effectors and their role in mitogenesis and oncogenesis.
8972729 1996 Generation of antibodies specific for the RalA and RalB GTP-binding proteins and determination of their concentration and distribution in human platelets.
7673236 1995 Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.
2662142 1989 Coding sequences of human ralA and ralB cDNAs.
2120779 1990 Chromosomal localization and cDNA sequence of human ralB, a GTP binding protein.