Property Summary

NCBI Gene PubMed Count 403
PubMed Score 1147.53
PubTator Score 1317.37

Knowledge Summary

Patent (237,802)

TINX Plot

  Disease (9)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.135 7.5e-03
astrocytoma 1.600 4.5e-03
ependymoma 1.400 1.3e-03
oligodendroglioma 1.500 1.5e-03
glioblastoma 1.400 1.0e-02
group 3 medulloblastoma 1.200 9.5e-04
ovarian cancer 2.100 5.3e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1728 confirmatory 0 / 32 / 40 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: c-Raf Inhibition
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (228)

PMID Text
26649302 our study suggested that black rice anthocyanins extract suppress metastasis in breast cancer cells by targeting the RAS/RAF/MAPK pathway
26513016 Up-regulation of Raf-1 is associated with triple-negative breast cancer.
26295714 This study provides the molecular basis for C-Raf C-terminal-derived phosphopeptide interaction with 14-3-3zeta protein and gives structural insights responsible for phosphorylation-mediated protein binding.
26100670 Besides mediating the anticancer effect, pDAPK(S308) may serve as a predictive biomarker for Raf inhibitors combination therapy, suggesting an ideal preclinical model that is worthy of clinical translation.
26048984 DJ-1 directly binds to the kinase domain of c-Raf to stimulate its self-phosphorylation, followed by phosphorylation of MEK and ERK1/2 in EGF-treated cells.
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1.
25817574 Suggest an interrelated kinase module involving c-Raf/PI3K/Lyn and perhaps Fgr functions in a nontraditional way during retinoic acid-induced maturation or during rescue of RA induction therapy using inhibitor co-treatment in RA-resistant leukemia cells.
25755752 Raf-1 may be an important biomarker in predicting the prognosis of chordoma patients.
25713071 Data indicate that cyclic AMP signaling reduces the expression of sirtuin 6 deacetylase via inhibition of the c-Raf-MEK1-ERK1/2 pathway.
25706034 Abnormal activation of the Ras/MAPK pathway may play a significant role in the development of pulmonary vascular disease in the subset of patients with Noonan syndrome and a specific RAF1 mutation.
25684575 In the presence of Raf1, the RasQ61L mutant has a rigid switch II relative to the wild-type and increased flexibility at the interface with switch I, which propagates across Raf-Ras binding domain.
25674762 Aberrant expression of A-, B-, and C-RAF, and COT is frequent in PTC; increased expression of COT is correlated with recurrence of PTC.
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
25473895 truncated RAF1 and BRAF proteins, recently described as products of genomic rearrangements in gastric cancer and other malignancies, have the ability to render neoplastic cells resistant to RTK-targeted therapy
25355599 our study demonstrated that miR-455-RAF1 may represent a new potential therapeutic target for colorectal carcinoma treatment.
25265753 Studied the promoter methylation and RNA expression profiles of ERK and RAF1 genes with risk of oral squamous cell carcinoma (OSCC) along with the promoter methylation status of ERK and RAF1 genes.
25027403 These data suggest that miR-7-5p functions as a tumor suppressor gene to regulate glioblastoma microvascular endothelial cell proliferation potentially by targeting the RAF1 oncogene
25022756 Results show that ubiquitination and levels of RAF-1 is controlled by both Shoc2 and HUWE1.
24969872 Including several anti-apoptotic Bcl-2 family members and c-Raf.
24863296 Authors demonstrate that the N-terminus of human Raf1 kinase (hRaf11-147aa) binds with human RKIP (hRKIP) at its ligand-binding pocket, loop "127-149", and the C-terminal helix by nuclear magnetic resonance experiments.
24777450 analysis of RAF1 mutations in cohorts of South Indian, North Indian and Japanese patients with childhood-onset dilated cardiomyopathy
24486585 A novel mechanism for response was discovered whereby high expression level of CAV-1 at the plasma membrane disrupts the BRaf/CRaf heterodimer and thus inhibits the activation of MAPK pathway during dasatinib treatment.
24427333 The higher expression of RAF1 mRNA and the activation of AKT/ERK proteins in vinorelbine-resistant non-small cell lung cancer cell lines may confer resistance to vinorelbine
24371145 Small G proteins Rac1 and Ras regulate serine/threonine protein phosphatase 5 (PP5).extracellular signal-regulated kinase (ERK) complexes involved in the feedback regulation of Raf1.
24223781 4 genes (EGFR, ERBB2, PTK2, and RAF1) with five SNPs (rs11238349, rs17172438, rs984654, rs11773818, and rs17172432) might be pivotal factors in the development of prostate cancer.
24108181 We hypothesize a potential direct or indirect role for SRC, RAF1, PTK2B genes in neurotransmission and in central nervous system signaling processes.
23923067 activation of RAF1-MEK1-ERK/AKT axis may determine the resistance of non-small cell lung cancer cell lines bearing wild type EGFR to erlotinib
23760062 Expression of miR-195 or knockdown of Raf-1 can similarly reduce tumor cell survival.
23737487 we identified multiple C-RAF mutations that produced biochemical and pharmacologic resistance in melanoma cell lines
23610963 Antisense oligonucleotides targeting BCL-2 and C-RAF transcripts in tumor cell lines increases sensitivity to cytotoxic effect of etoposide.
23559827 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
23554973 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
23517740 Aberrant BRAF splice variants with deletions in both kinase and RAS-binding domains in rheumatoid arthritis patients demonstrate that these BRAF splice variants constitutively activate MAPK through CRAF
23360980 The ability of MEK to activate C-Raf was only partially dependent on MEK kinase activity but required MEK binding to C-Raf, suggesting that the binding results in a conformational change that increases C-Raf susceptibility to phosphorylation
23352452 Ras pathway activation via EGF treatment induced strong binding between B-Raf and C-Raf and a low level of binding between B-Raf and A-Raf.
23157514 DiRas3 interacts with C-RAF and downregulates MEK1 activity to restrict cell migration.
23118896 these findings establish RanBPM as a novel inhibitor of the ERK pathway through an interaction with the c-Raf complex and a regulation of c-Raf stability
23105109 The dominant effect of prolonged USP15 depletion upon signal amplitude is due to a decrease in CRAF levels while allowing for the possibility that USP15 may also function to dampen MAPK signaling through direct stabilization of BRAP.
23087049 results suggest a novel mechanism that the interaction of Raf-1 with cytoskeletal actin is critical for Raf-1 redistribution and airway smooth muscle cell proliferation during activation with the growth factor
23076151 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
22935974 osteosarcoma patients whose tumors expressed raf-1 had a poorer clinical outcome than those whose tumors did not.
22926515 ARAF seems to stabilize BRAF:CRAF complexes in cells treated with RAF inhibitors and thereby regulate cell signaling in a subtle manner to ensure signaling efficiency
22922483 Determination of a 1:1 stoichiometry for the diphosphorylated peptide binding to one 14-3-3zeta dimer with isothermal titration calorimetry was supported by the crystal structure of the 14-3-3zeta/C-RAFpS233,pS259 complex.
22907845 Gefitinib reverses the MDR protein gene expression and restores sensitivity of pancreatic cancer cells resistant to gemcitabine via RAF1/ERK signaling pathway.
22833462 Investigated BRAF and RAF1 alterations in Chinese prostate cancer.Found BRAF truncated in five of 200 informative Chinese cases & RAF1 was truncated in three of 204 informative cases and genomic rearrangements were correlated w/high Gleason scores.
22826437 RAF1(D486N), as well as other kinase-impaired RAF1 mutants, showed increased heterodimerization with BRAF, which was necessary and sufficient to promote increased MEK/ERK activation.
22752602 Data indicate that erufosine caused dose-dependent decreases in the phosphorylation of PI3K (p85), Akt (PKB) at Thr 308 and cRaf in both MCF-7 and MDA-MB 231 cell lines.
22738312 These findings demonstrate that overexpression of Raf-1, p-Raf-1 or both could be considered as a new independent prognostic biomarker for poor survival rates for non-small cell lung cancer patients
22711539 unknown role for ML-IAP in controlling C-RAF stability and cell migration.
22605333 The consequence of complex formation is a DiRas3-mediated recruitment and anchorage of C-RAF to components of the membrane skeleton, suppression of C-RAF/B-RAF heterodimerization, and inhibition of C-RAF kinase activity.
22556409 PP242 mTOR inhibitor activates ERK in multiple myeloma cells via a target of rapamycin complex 1 (TORC1)/eukaryotic translation initiation factor 4E (eIF-4E)/RAF pathway and activation is a mechanism of resistance
22464151 RKIP expression may serve as a novel clinical biomarker in patients with esophageal squamous cell carcinoma.
22447278 amplification of Raf1, MEK/MAPK oncogenic signaling during tumor growth promotes the genesis of metastatic lesions from primary tumors by activating the mesenchymal epithelial transition.
22421411 Interleukin-6, osteopontin and Raf/MEK/ERK signaling modulate the sensitivity of human myeloma cells to alkylphosphocholines.
22389993 LEOPARD syndrome, both with proven mutations in the RAF1 gene not previouslyreported
22282237 Raf-1/JNK /p53/p21 pathway may be involved in apoptosis, and NFkappaB1 may play a possible role in inhibiting apoptosis.
22262839 Data show that bilirubin interacts with the Raf/ERK/MAPK pathway, effect on cyclin D1 and Raf content, altered retinoblastoma protein profile of hypophosphorylation, calcium influx, and YY1 proteolysis.
22225925 Cellular Raf-1 levels determine endometrial stromal cell motility and morphology.
22138288 Ras/Raf-1/MEK/ERK signal pathway is important for chemokine ligand CCL2-induced migration activity and matrix metalloproteinase (MMP)-9 expression.
22131876 Conditional expression of oncogenic C-RAF in mouse pulmonary epithelial cells reveals differential tumorigenesis and induction of autophagy leading to tumor regression.
22110214 High RAF1 is associated with hepatocellular carcinoma.
22103831 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
22096607 ndings demonstrate that Pak1 phosphorylates BAD directly at S111, but phosphorylated S112 through Raf-1.
22081024 CRAF is required for mitotic progression. Phospho-Ser338 CRAF is upregulated in mitosis and localizes to the mitotic spindles in human cell lines and tumor biopsies.
22020327 These results demonstrate that replicative and oxidative stresses are not required for RAF-induced senescence, and this senescence is readily reversed upon loss of cyclin-dependent kinases.
21917714 Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
21892329 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
21881167 Report cooperative effects of Akt-1 and Raf-1 on the induction of cellular senescence in doxorubicin or tamoxifen treated breast cancer cells.
21871886 study demonstrates a novel role of the Raf/MEK/ERK pathway in regulating AR expression in certain PCa types and provides an insight into PCa responses to its aberrant activation
21808062 The H-Ras-ERK-induced and HO-1-mediated pathway could protect renal cancer cells from apoptosis.
21617351 Downregulation of RKIP increased the level of free Raf-1 and thereby elevated the mitochondrial translocation of Raf-1 during HBx-mediated hepatocarcinogenesis.
21577205 Studies indicate that Raf kinases are excellent molecular targets for anticancer therapy.
21514245 c-Raf plays a unique role in mediating K-Ras signaling in non-small cell lung carcinoma and makes it a suitable target for therapeutic intervention.
21215703 EZH2 expression-mediated downregulation of DNA damage repair leads to accumulation of recurrent RAF1 gene amplification in breast tumor initiating cells (BTICs), which activates p-ERK-beta-catenin signaling to promote BTIC expansion.
21207082 Hepatitis B virus could up-regulate Raf1 expression by enhancing the activity of its promoter in a dose-dependent manner, and HBs and HBx may be involved in this process.
21122381 JNK1, Raf-1 and Livin may be involved in the carcinogenesis of sporadic colorectal tubular adenoma.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20868603 Raf-1 over-expression was an independent prognostic factor of poor survival in hepatocellular carcinoma.
20854332 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
20688353 Reduction in Raf-1 kinase inhibitory protein expression in gallbladder carcinoma contributes to invasion and metastasis and is a significant prognostic marker in patients with gallbladder carcinoma.
20679480 Findings suggest that modulating the C-RAFSer(259)/14-3-3 protein-protein interaction with a stabilizing small molecule may yield a novel potential approach for treatment of diseases resulting from an overactive Ras-RAF-MAPK pathway.
20630999 Results suggest that RAGE, NOX, and H-Ras/Raf-1 are implicated in the up-regulation of HSF1 or PAI-1 in vascular EC under diabetes-associated metabolic stress.
20543023 Observational study of gene-disease association. (HuGE Navigator)
20489206 Leukotriene B(4) BLT receptor signaling regulates the level and stability of cyclooxygenase-2 (COX-2) mRNA through restricted activation of Ras/Raf/ERK/p42 AUF1 pathway
20404846 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
20389169 Based on our results, it is possible that a subtle dysfunction (expression) of the RAF1 gene is involved in the development of the most common male reproductive tract disorder - unilateral or bilateral cryptorchidism
20372086 Raf-1 was dominant in terms of promoting both cell cycle progression and preventing apoptosis when compared to Akt-1
20364151 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
20302979 Observational study of gene-disease association. (HuGE Navigator)
20234004 Infection with Chlamydia trachomatis led to the Akt-dependent, increased phosphorylation (and inactivation) of Raf-1 at serine-259.
20230813 Study demonstrates that human TAP-1 regulates signaling in vertebrate cells, acting at a previously uncharacterized step of the Ras pathway by inhibiting the ability of Raf to translocate to activated Ras at the cell membrane.
20086174 Data show T117/T384 as Akt phosphorylation sites in MST2, and mutation of these sites inhibited MST2 binding to Raf-1 but enhanced binding to RASSF1A, accentuating downstream c-jun N-Terminal Kinase and p38 MAPK signaling and promoting apoptosis.
20071468 Results indicate that the Shoc2 scaffold protein modulates Ras-dependent Raf1 activation in a Ca(2+)- and calmodulin-dependent manner.
20052757 dephosphorylation of S259 is the primary pathogenic mechanism in the activation of RAF1 mutants located in the CR2 domain as well as of downstream ERK
19953625 Noonan syndrome (NS) is an autosomal dominant disorder caused by mutations in several proteins, including RAF1, which may later involve tumor onsets.
19917255 Data show that melanoma cells expressing B-Raf(V600E) display a reduced C-Raf:B-Raf ratio, and further suppression of C-Raf increases MAPK activation and proliferation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895838 Data show that RAF not only neutralizes BAD's pro-apoptotic activity but activates it for a new function as a pore.
19881545 Bcl-2-associated anthanogene 1 (BAG-1)'s effects were associated with an activation of RAF-1-a known binding partner of BAG-1, enhanced signaling through the MAP kinase pathway and a decrease in BIM expression.
19825990 Thus, the short hairpin-looped ODN-Raf, targeting the same region of c-raf-1 as miR-125b, is a multifunctional molecule reducing the expression of oncoproteins and stimulating cell death.
19812696 analysis of molecular pertubations allowing dysplasia to progress further to adenocarcinoma induced by exaggerted c-Raf kinase activity
19802003 Data show that in hypoxic conditions or coexpressed with a constitutively active form of HIF-1alpha, c-Kit mutants activate the Ras/Raf/Mek/Erk pathway, stimulate proliferation and transform melanocytes.
19801192 Studies provide models for Ras in association with Raf kinase, RalGDS and PI3Kalpha and PI3Kgamma.
19737955 The C-Raf expression is up-regulated in a subset of melanomas but not in nevi, suggesting that it might be a valuable diagnostic marker and therapeutic target.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19718030 DC-SIGN was constitutively associated with a signalosome complex consisting of the scaffold proteins LSP1, KSR1 and CNK and the kinase Raf-1.
19710016 DGKeta acts as a novel critical regulatory component of the Ras/B-Raf/C-Raf/MEK/ERK signaling cascade via a previously unidentified mechanism.
19638615 Data show that in the presence of negative feedback, changes in the rate of Ras-c-Raf binding have little effect on ERK activation.
19638574 Sorafenib inhibits NSCLC cell growth by targeting B-RAF in cells with wild-type KRAS and C-RAF in those with mutant KRAS.
19633425 Data show that sorafenib inhibited the raf/ MEK/ERK signal pathway, and downregulated cyclin D1 and Rb levels.
19595761 Phosphorylation of S621 turns over rapidly and is enriched in the activated pool of endogenous Raf-1.
19492075 Targeting NRAS alone or both BRAF and CRAF in combination or both BRAF and PIK3CA together showed delay in tumor growth.
19380724 GILZ1 and SGK1 provide a physical and functional link between the PI3K- and Raf-1-dependent signaling modules
19363522 Oncogenic RAF1 rearrangement and a novel BRAF mutation as alternatives to KIAA1549:BRAF fusion in activating the MAPK pathway in pilocytic astrocytoma.
19357705 loss of RKIP is a functional somatic event in carriers of C-RAF germline mutations, which contributes to the development of t-AML
19298812 Results identify a nuclear redistribution of Raf1 during the retinoic acid-induced differentiation of HL-60 cells.
19206169 Observational study of gene-disease association. (HuGE Navigator)
19133693 Observational study of gene-disease association. (HuGE Navigator)
19122653 dectin-1 activates two independent signaling pathways, one through Syk and one through Raf-1, to induce immune responses.
19058874 Vitamin D3-triggered differentiation of human myeloid leukemia cells depends on downregulation of Akt, which dissociates from Raf1 and activates MAPK signaling.
19047752 Alpha-adducin and Raf-1 kinase are redistributed and localized to the inclusion membrane in Chlamydia and Chlamydophila infected cells.
19037990 RAF may induce cell proliferation through hypermethylation of tumor suppressor gene p16INK4A
19020799 Mutations in the RAF1 are associated with Noonan syndrome.
19020799 Observational study of gene-disease association. (HuGE Navigator)
19011619 These data show an unexpected role of XIAP and cellular-inhibitor of apoptosis proteins in the turnover of C-RAF protein, thereby modulating the MAPK signalling pathway and cell migration.
19001375 the molecular interactions of arrestin2 and arrestin3 and their individual domains with the components of the two MAPK cascades, ASK1-MKK4-JNK3 and c-Raf-1-MEK1-ERK2
18952605 phosphatidate promotes ERK phosphorylation in intact cells but does not activate Raf in vitro
18794803 study identified a group of melanomas with low-activity BRAF mutations (G469E- and D594G) that are reliant upon CRAF-mediated survival activity
18715846 The state of activation of components of mTOR, Ras/Raf kinase/ERK, and nuclear factor (NF)-kappaB signal transduction pathways, as well as cell cycle protein analyte correlates in gastric adenocarcinoma cases, was examined.
18708364 AhR is a master regulator of c-raf and propose cross-talk between AhR and the mitogen-activated protein kinase signaling pathway.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18592002 RAS signaling in colorectal carcinomas through alteration of RAS, RAF, NF1, and/or RASSF1a.
18483265 the Rb/Raf-1 interaction has a role in cell proliferation and angiogenesis
18472967 Increased Raf-1 kinase is associated with glioma formation
18465753 PAK5 is a potent regulator of Raf-1 activity and may control Raf-1 dependent signaling at mitochondria
18356164 C-RAF is the only isoform that directly binds mitochondria
18316782 These results suggest that oncogenic ras-p21 induces phosphorylation of both raf-Ser259 and Ser338 and that raf-Ser 259 phosphorylation may be effected by activated JNK.
18294816 Loss-of-function RKIP mutants still appear to bind to Raf-1. However the stability of the complexes formed between mutants and the N-region Raf-1 phosphopeptide were drastically reduced.
18241070 Observational study of gene-disease association. (HuGE Navigator)
18182859 These results suggest that 0.05 Gy of ionizing radiation stimulates cell proliferation through the transient activation of Raf and Akt in CCD-18 Lu cells.
18064632 GRP78 may stabilize Raf-1 to maintain mitochondrial permeability and thus protect cells from endoplasmic reticulum stress-induced apoptosis.
18006502 Raf-1 in beta-cells led to a striking loss of Bad phosphorylation at serine 112 and an increase in the protein levels of both Bad and Bax
17998336 activated Ras, Golgi apparatus-localized Lck is needed for the full activation of Raf-1
17889508 A pathway comprising PKCs>Raf-1>MEK-1>ERK-1/-2 mediates the effect of gastrin on the CgA promoter, and strongly suggests that enhanced phosphorylation of Sp1 and CREB is crucial for CgA transactivation through the G protein-coupled CCK-B/gastrin receptor.
17724343 reveal a paradigm of spatial regulation of Raf kinase by RKTG via sequestrating Raf-1 to the Golgi apparatus and thereby inhibiting the ERK signaling pathway
17635919 In contrast to C-RAF that requires farnesylated H-Ras, cytosolic B-RAF associates effectively and with significantly higher affinity with both farnesylated and nonfarnesylated H-Ras.
17614099 Raf-1 may interfere with the role of Rad24 by competing with Rad24 for binding to Cdc25 in DNA repair, bypassing the checkpoint pathway through Cdc25 activation.
17603483 Study reports that 18 of 231 individuals with Noonan syndrome and 2 of 6 individuals with LEOPARD syndrome without PTPN11 mutations have missense mutations in RAF1, which encodes a serine-threonine kinase that activates MEK1 and MEK2.
17603482 Study identified 5 mutations in RAF1 in 10 individuals with Noonan syndrome; those with mutations causing changes in the CR2 domain of RAF1 had hypertrophic cardiomyopathy, while those with mutations leading to changes in the CR3 domain did not.
17572489 results show overexpression of RAF-1 in mantle cell leukemia compared with tonsilar B-lymphocytes
17462920 different pathogens (ie. Mycobacterium tuberculosis, M. leprae, Candida albicans, measles virus, and HIV-1) interacted with DC-SIGN to activate the Raf-1-acetylation-dependent signaling pathway to modulate signaling by different TLRs
17462920 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
17428866 Hepatitis B virus X protein stimulates the mitochondrial translocation of Raf-1 via oxidative stress
17397260 The results suggest that multiple cellular signaling pathways can reactivate the virus in a genetically homogeneous cell population. Further analysis revealed that the Raf/MEK/ERK/Ets-1 pathway mediates Ras-induced reactivation.
17332776 The interaction between eEF-1A and C-Raf increases eEF-1A stability and induces a survival activity.
17277048 in human airway smooth muscle cells: TNF-alpha transactivation of the EGF receptor, with subsequent raf-1 kinase-mediated activation of adenylyl cyclase are two linked signaling pathways
17243098 Data suggest that Raf-1 may interfere with the role of Rad24 by competing with Rad24 for binding to Cdc25 or a direct phosphorylation of Cdc25, bypassing the checkpoint pathway in DNA repair through Cdc25 activation.
17097642 The Raf kinase inhibitory protein (RKIP) binds to Raf-1 interfering with binding of the MEK substrate and potentially also Raf-1 activation.
17064357 Based on these findings, we speculate that Raf-1 is activated to effectively mediate Ras-dependent signals in Alzheimer's disease.
17018604 cAMP suppresses CRAF in melanocytes. This suppresses the oncogenic potential of CRAF. When RAS is mutated in melanoma, the cells switch their signaling from BRAF to CRAF, dysregulating cAMP signaling & allowing CRAF to signal to MEK.
16964381 These studies identify XIAP as a new substrate of Raf-1.
16924233 These findings support a role of Slug in mediating Raf 1-induced transcriptional repression of occludin and subsequent epithelial to mesenchymal transition.
16909118 findings identify MEK/ERK as a new signaling pathway activated by NPM/ALK and indicate that the pathway represents a novel therapeutic target in the ALK-induced malignancies
16883571 These findings support the thesis that Raf-1 signals cell proliferation and cell differentiation through different intermediary proteins.
16862215 Nicotine induces cell proliferation by beta-arrestin-mediated activation of the Src and Rb-Raf-1 pathways om ;img camcer.
16803888 Rheb has a central role in the regulation of the Ras/B-Raf/C-Raf/MEK signaling network
16707572 This work provides new insight into how the cell microenvironment may influence Raf-1 expression to modulate cell-Fibronectin interactions in 3D.
16575407 Rodent and human tumor cells containing constitutively activated Raf/Raf/MEK/ERK pathways were resistant to mda-5-induced killing.
16569214 intracellular generation of NO* by nNOS leads to S-nitrosylation of H-Ras, which interferes with Raf-1 activation and propagation of signalling through ERK1/2
16565089 CD44 interaction with LARG and EGFR plays a pivotal role in Rho/Ras co-activation, PLC epsilon-Ca2+ signaling, and Raf/ERK up-regulation required for CaMKII-mediated cytoskeleton function and in head and neck squamous cell carcinoma progression
16537381 Merlin and MLK3 can interact in situ and merlin can disrupt the interactions between B-Raf and Raf-1 or those between MLK3 and either B-Raf or Raf-1.
16465392 inhibition of Raf-1 using an antisense raf oligonucleotide (AS-raf-ODN) to identify downstream targets of Raf-1 using microarray gene expression analysis
16364920 Data suggest that B-RAF activates C-RAF through a mechanism involving 14-3-3 mediated heterooligomerization and C-RAF transphosphorylation.
16332724 data suggest that Raf-1 is the predominant Raf isoform responsible for regulating cellular growth in ovarian cancer cells and may be particularly important in high grade serous ovarian cancers
16301319 Erbin has a regulatory role in the Ras-Raf-MEK pathway and may inhibit ERK activation by disrupting the Sur-8-Ras/Raf interaction
16266749 Coll I activates the ERK/MAP Kinase pathway in Jurkat T cells through the activation of Ras and Raf-1.
16239230 PP2A ABalphaC and ABdeltaC holoenzymes function as positive regulators of Raf1-MEK1/2-ERK1/2 signaling by targeting Raf1
16172610 selective reduction in catalytic activity and expression of B-Raf but not Raf-1 suggest that B-Raf may be playing an important role in altered ERK signaling in brain of suicide subjects, and thus in the pathophysiology of suicide
16086581 results suggest that activated JNK can, in turn, activate not only jun but also raf that, in turn, activates MEK that can then cross-activate JNK in a positive feedback loop
16029117 Activation of raf-1 leads to cessation of cell growth and suppression of calcitonin and chromogranin A production
15925322 Raf-1 may mediate its anti-apoptotic function by interrupting ASK1-dependent phosphorylation of ALG-2.
15899852 Raf-1 phosphorylation on serine 338 (S338) is a critical step in EGF aktivation of ERK that is lost in nonadherent cells.
15849194 Pak1-dependent Raf-1 phosphorylation regulates its mitochondrial localization, phosphorylation of BAD, and Bcl-2 association
15845549 activation is regulated by CNK1
15711535 essential role of Ras-induced conformational change in mitogen-activated protein kinase kinase activation by c-Raf
15710605 regulated by an N-terminal autoinhibitory domain whose actions are blocked by interaction with Ras
15674327 Role for caspase-9 mediated cleavage of Raf-1 in the negative feedback regulation of hematopoietic cell apoptosis induced by growth factor withdrawal.
15666389 the HER2/Raf-1/AP-1 axis may promote the development of androgen insensitive prostate cancer, leading to early relapse
15662129 Raf-1 may be involved in angiogenesis by controlling the expression of angiogenesis-related factors; study provides a possible strategy for the treatment of tumor angiogenesis by targeting Raf-1
15657590 The induction of the raf-1/MEK1 pathway blocks IGF-1-mediated intracellular neuroendocrine hormone regulation. This pathway may be a therapeutic target in gastrointestinal carcinoid tumor therapy.
15653554 a novel Ras-independent ERK1/2 activation system in which p110gamma/Raf-1/MEK1/2 and PKA/B-Raf/MEK1/2 cooperate to activate ERK1/2.
15618521 proteomic analysis of Raf-1 signaling complexes was used to show that Raf-1 counteracts apoptosis by suppressing the activation of mammalian sterile 20-like kinase (MST2)
15591313 findings indicate that ligation of retinol to a specific site embedded in the regulatory domain is an important feature of c-Raf regulation in the redox pathway.
15485920 Raf-1 links mitogenic signaling to Retinoblastoma Protein and that disruption of this interaction could aid in controlling proliferative disorders
15470083 Raf1 potentiates drug-stimulated cyclic AMP accumulation in cells expressing adenyl cyclcase 6 after activation of multiple signaling pathways.
15451031 Raf1 and MAPK-activated protein kinase 2 are activated by L-ascorbic acid in acute myeloid leukemia cells.
15314064 Raf1 kinase is released when it is hyperphosphorylated and activated during oxidative and other stresses
15211515 Changes in flexibility upon protein-protein complex formation of H-Ras & the Ras-binding domain of C-Raf1 have been investigated using the molecular framework approach FIRST and molecular dynamics simulations of in total approximately 35 ns length.
15122343 RAF1 promotes herpesvirus 8 infection.
15067053 Despite the effects of constitutively active Raf on pro-B cell expansion in Raf transgenic mice, Raf activation is not sufficient to rescue early B cell development in IL-7 receptor-deficient mice.
15041731 Ovarian cancers demonstrate differential sensitivity to antisense oligonucleotides targeted against Raf-1, and target expression levels.
14688025 mutation analysis of the conserved regions in the RAF1 gene in human colorectal adenocarcinoma
14623285 together, our data suggest that the synergistic activation of Raf-1 kinase in response to PMA and H(2)O(2) occurs via mechanisms that involve an interaction of Raf-1 kinase and PKC-epsilon.
12954639 Raf-1 has a role in modulating integrin-stimulated ERK activation when bound to CAMKII
12925535 a functional phosphatidate binding site is necessary for Raf-1 function in embryonic development
12865432 Raf is regulated through phosphorylation and N terminus-C terminus interaction
12851216 results show that raf-1 protein induction suppresses neuroendocrine marker and hormone production in human gastrointestinal carcinoid cells via a pathway dependent on MEK activation
12843393 findings implicate Raf-1 as a pivotal regulator of endothelial cell survival during angiogenesis
12734410 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
12717443 Sprouty4 binds to Raf1 through its carboxy-terminal cysteine-rich domain, and this binding is necessary for the inhibitory activity of Sprouty4.
12691824 Raf1 may have a role in antineoplastic drug resistance
12682854 The 1,25(OH)(2)D3-responsive element in cystatin A gene is identical to TRE, T2 (-272 to -278). Suppression of Raf-1/MEK1/ERK1,2 signaling pathway increases cystatin A expression of normal human keratinocytes.
12663662 serum stimulation of fibroblasts in floating matrices does not result in ERK translocation to the nucleus and there was decreased serum activation of upstream members of the ERK signaling pathway, MEK and Raf.
12626521 c-Raf1 activation occurs without serine 338 phosphorylation
12551923 phosphorylation by p21-activated kinase 1 and Src regulates Raf-1 autoinhibition
12490852 Activation of the ras/raf-1 signal transduction pathway leads to prominent phenotypic changes that resemble differentiation of gastrointestinal carcinoid cells in vitro.
12429936 Raf activation increased the expression of cyclin A, cyclin D, cyclin E, and p21(Cip1), which are associated with G(1) progression
12391160 These data suggest that GILZ contributes, through protein-to-protein interaction with Raf-1 and the consequent inhibition of Raf-MEK-ERK activation, to regulating the MAPK pathway and to providing a further mechanism underlying GCH immunosuppression.
12244094 Results indicate that the phosphorylation of Ser(338) and Tyr(341) on Raf-1 exerts an important effect on reconfiguring the two MEK1-binding sites.
12087097 effects of paclitaxel on Raf-1 phosphorylation in ovarian cancer cells
12010819 targeted expression inhibits juvenile myelomonocytic leukemia cell growth
11948406 PAK1 primes MEK1 for phosphorylation by Raf-1 kinase during cross-cascade activation of the ERK pathway.
11756411 These data show that Ser-259 dephosphorylation contributes to Raf-1 activation by supporting its membrane accumulation rather than by increasing the specific activity of the kinase
11463741 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
9658081 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
9624170 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
8887682 HIV-1 gp120-induced release of IL-10 depends on the activation of Raf-1 along with NF-kappaB p65 in immature dentritic cells
8621729 c-Raf interacts with MEK1 and activates MEK1 by phosphorylation.

AA Sequence

MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVV      1 - 70
NVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHN     71 - 140
FARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALP    141 - 210
SLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDA    211 - 280
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVM    281 - 350
LSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV    351 - 420
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLA    421 - 490
TVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFM    491 - 560
VGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAH    561 - 630
TEDINACTLTTSPRLPVF                                                        631 - 648
//

Text Mined References (426)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26649302 2015 Black Rice Anthocyanins Suppress Metastasis of Breast Cancer Cells by Targeting RAS/RAF/MAPK Pathway.
26513016 2015 Lapatinib increases motility of triple-negative breast cancer cells by decreasing miRNA-7 and inducing Raf-1/MAPK-dependent interleukin-6.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26295714 2015 Biophysical Characterization of Essential Phosphorylation at the Flexible C-Terminal Region of C-Raf with 14-3-3? Protein.
26100670 2015 Novel Cancer Therapeutics with Allosteric Modulation of the Mitochondrial C-Raf-DAPK Complex by Raf Inhibitor Combination Therapy.
26048984 2015 Epidermal Growth Factor-dependent Activation of the Extracellular Signal-regulated Kinase Pathway by DJ-1 Protein through Its Direct Binding to c-Raf Protein.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25817574 2015 GW5074 and PP2 kinase inhibitors implicate nontraditional c-Raf and Lyn function as drivers of retinoic acid-induced maturation.
25755752 2015 Overexpression of Raf-1 and ERK1/2 in sacral chordoma and association with tumor recurrence.
25713071 2015 Cyclic AMP signaling reduces sirtuin 6 expression in non-small cell lung cancer cells by promoting ubiquitin-proteasomal degradation via inhibition of the Raf-MEK-ERK (Raf/mitogen-activated extracellular signal-regulated kinase/extracellular signal-regulated kinase) pathway.
25706034 2015 Neonatal pulmonary arterial hypertension and Noonan syndrome: two fatal cases with a specific RAF1 mutation.
25684575 2015 Allosteric effects of the oncogenic RasQ61L mutant on Raf-RBD.
25674762 2015 Aberrant expression of COT is related to recurrence of papillary thyroid cancer.
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25473895 2015 Truncated RAF kinases drive resistance to MET inhibition in MET-addicted cancer cells.
25355599 2015 MicroRNA-455 inhibits proliferation and invasion of colorectal cancer by targeting RAF proto-oncogene serine/threonine-protein kinase.
25265753 2014 ERK and RAF1 genes: analysis of methylation and expression profiles in patients with oral squamous cell carcinoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25155755 2014 Structure of the BRAF-MEK complex reveals a kinase activity independent role for BRAF in MAPK signaling.
25137548 2014 A Novel SHOC2 Variant in Rasopathy.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25027403 2014 MiR-7-5p is frequently downregulated in glioblastoma microvasculature and inhibits vascular endothelial cell proliferation by targeting RAF1.
25022756 2014 HUWE1 is a molecular link controlling RAF-1 activity supported by the Shoc2 scaffold.
24969872 2014 Bag-1L is a stress-withstand molecule prevents the downregulation of Mcl-1 and c-Raf under control of heat shock proteins in cisplatin treated HeLa cervix cancer cells.
24863296 2014 Structural basis for RKIP binding with its substrate Raf1 kinase.
24777450 2014 RAF1 mutations in childhood-onset dilated cardiomyopathy.
24746704 2014 Disruption of CRAF-mediated MEK activation is required for effective MEK inhibition in KRAS mutant tumors.
24736947 2014 Conserved oncogenic behavior of the FAM83 family regulates MAPK signaling in human cancer.
24486585 2014 Cross-talk between EphA2 and BRaf/CRaf is a key determinant of response to Dasatinib.
24427333 2014 Activation of AKT/ERK confers non-small cell lung cancer cells resistance to vinorelbine.
24371145 2014 Small G proteins Rac1 and Ras regulate serine/threonine protein phosphatase 5 (PP5)·extracellular signal-regulated kinase (ERK) complexes involved in the feedback regulation of Raf1.
24330068 2014 Nuclear Raf-1 kinase regulates the CXCR5 promoter by associating with NFATc3 to drive retinoic acid-induced leukemic cell differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24223781 2013 RTK/ERK pathway under natural selection associated with prostate cancer.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24108181 2013 Network analysis of neurotransmitter related human kinase genes: possible role of SRC, RAF1, PTK2B?
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23923067 2013 RAF1-MEK1-ERK/AKT axis may confer NSCLC cell lines resistance to erlotinib.
23760062 2013 Upregulation of miR-195 increases the sensitivity of breast cancer cells to Adriamycin treatment through inhibition of Raf-1.
23737487 2013 C-RAF mutations confer resistance to RAF inhibitors.
23680146 2013 RAF inhibitors activate the MAPK pathway by relieving inhibitory autophosphorylation.
23610963 Cytotoxicity of etoposide in cancer cell lines in vitro after BCL-2 and C-RAF gene silencing with antisense oligonucleotides.
23517740 2013 BRAF splice variants in rheumatoid arthritis synovial fibroblasts activate MAPK through CRAF.
23509299 2013 Phosphodiesterase-8A binds to and regulates Raf-1 kinase.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23360980 2013 MEK-1 activates C-Raf through a Ras-independent mechanism.
23352452 2013 Effects of Raf dimerization and its inhibition on normal and disease-associated Raf signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23157514 2013 The tumour suppressor DiRas3 interacts with C-RAF and downregulates MEK activity to restrict cell migration.
23118896 2012 RanBPM is an inhibitor of ERK signaling.
23105109 2012 Direct and indirect control of mitogen-activated protein kinase pathway-associated components, BRAP/IMP E3 ubiquitin ligase and CRAF/RAF1 kinase, by the deubiquitylating enzyme USP15.
23087049 2013 Raf-1, actin dynamics, and abelson tyrosine kinase in human airway smooth muscle cells.
23076151 2012 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22935974 2012 Mitogen-activated protein kinase pathway in osteosarcoma.
22926515 2013 ARAF acts as a scaffold to stabilize BRAF:CRAF heterodimers.
22922483 2012 Synergistic binding of the phosphorylated S233- and S259-binding sites of C-RAF to one 14-3-3? dimer.
22907845 2012 Reversal of multidrug resistance by gefitinib via RAF1/ERK pathway in pancreatic cancer cell line.
22886303 2012 FAM83A confers EGFR-TKI resistance in breast cancer cells and in mice.
22886302 2012 FAM83B mediates EGFR- and RAS-driven oncogenic transformation.
22833462 2012 Identification of frequent BRAF copy number gain and alterations of RAF genes in Chinese prostate cancer.
22826437 2012 Increased BRAF heterodimerization is the common pathogenic mechanism for noonan syndrome-associated RAF1 mutants.
22752602 2012 Erufosine suppresses breast cancer in vitro and in vivo for its activity on PI3K, c-Raf and Akt proteins.
22738312 2012 Prognostic impact of Raf-1 and p-Raf-1 expressions for poor survival rate in non-small cell lung cancer.
22711539 2012 Role of melanoma inhibitor of apoptosis (ML-IAP) protein, a member of the baculoviral IAP repeat (BIR) domain family, in the regulation of C-RAF kinase and cell migration.
22605333 2012 The tumor suppressor DiRas3 forms a complex with H-Ras and C-RAF proteins and regulates localization, dimerization, and kinase activity of C-RAF.
22556409 2012 The PP242 mammalian target of rapamycin (mTOR) inhibitor activates extracellular signal-regulated kinase (ERK) in multiple myeloma cells via a target of rapamycin complex 1 (TORC1)/eukaryotic translation initiation factor 4E (eIF-4E)/RAF pathway and activation is a mechanism of resistance.
22510884 2012 Distinct requirement for an intact dimer interface in wild-type, V600E and kinase-dead B-Raf signalling.
22464151 2012 Reduced expression of Raf-1 kinase inhibitory protein predicts regional lymph node metastasis and shorter survival in esophageal squamous cell carcinoma.
22447278 2012 Raf-1 oncogenic signaling is linked to activation of mesenchymal to epithelial transition pathway in metastatic breast cancer cells.
22421411 2012 Interleukin-6, osteopontin and Raf/MEK/ERK signaling modulate the sensitivity of human myeloma cells to alkylphosphocholines.
22389993 Two cases of LEOPARD syndrome--RAF1 mutations firstly described in children.
22282237 2012 Molecular mechanisms underlying the time-dependent autophagy and apoptosis induced by nutrient depletion in multiple myeloma: a pilot study.
22262839 2012 Essential roles of Raf/extracellular signal-regulated kinase/mitogen-activated protein kinase pathway, YY1, and Ca2+ influx in growth arrest of human vascular smooth muscle cells by bilirubin.
22225925 2012 Raf-1 levels determine the migration rate of primary endometrial stromal cells of patients with endometriosis.
22169110 2011 Nilotinib and MEK inhibitors induce synthetic lethality through paradoxical activation of RAF in drug-resistant chronic myeloid leukemia.
22138288 2012 CCL2 increases MMP-9 expression and cell motility in human chondrosarcoma cells via the Ras/Raf/MEK/ERK/NF-?B signaling pathway.
22131876 2011 Conditional expression of oncogenic C-RAF in mouse pulmonary epithelial cells reveals differential tumorigenesis and induction of autophagy leading to tumor regression.
22110214 2011 Correlation of gene expression of ATP-binding cassette protein and tyrosine kinase signaling pathway in patients with hepatocellular carcinoma.
22096607 2011 p21-Activated kinase 1 (Pak1) phosphorylates BAD directly at serine 111 in vitro and indirectly through Raf-1 at serine 112.
22081024 2011 A MEK-independent role for CRAF in mitosis and tumor progression.
22020327 2012 Parallel pathways in RAF-induced senescence and conditions for its reversion.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21917714 2011 Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
21881167 2011 Cooperative effects of Akt-1 and Raf-1 on the induction of cellular senescence in doxorubicin or tamoxifen treated breast cancer cells.
21871886 2011 The Raf/MEK/extracellular signal-regulated kinase 1/2 pathway can mediate growth inhibitory and differentiation signaling via androgen receptor downregulation in prostate cancer cells.
21831839 2011 15-Lipoxygenase 1 interacts with phosphatidylethanolamine-binding protein to regulate MAPK signaling in human airway epithelial cells.
21808062 2011 The heme oxygenase-1 protein is overexpressed in human renal cancer cells following activation of the Ras-Raf-ERK pathway and mediates anti-apoptotic signal.
21779496 2011 Raf family kinases: old dogs have learned new tricks.
21617351 2011 RKIP downregulation induces the HBx-mediated Raf-1 mitochondrial translocation.
21577205 2011 Raf kinases in cancer-roles and therapeutic opportunities.
21536655 2011 The Ras signaling inhibitor LOX-PP interacts with Hsp70 and c-Raf to reduce Erk activation and transformed phenotype of breast cancer cells.
21514245 2011 c-Raf, but not B-Raf, is essential for development of K-Ras oncogene-driven non-small cell lung carcinoma.
21457714 2011 The membrane localization of Ras2p and the association between Cdc25p and Ras2-GTP are regulated by protein kinase A (PKA) in the yeast Saccharomyces cerevisiae.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21269460 2011 Initial characterization of the human central proteome.
21215703 2011 EZH2 promotes expansion of breast tumor initiating cells through activation of RAF1-?-catenin signaling.
21207082 2011 Hepatitis B virus regulates Raf1 expression in HepG2.2.15 cells by enhancing its promoter activity.
21139044 2010 Rb-Raf-1 interaction disruptor RRD-251 induces apoptosis in metastatic melanoma cells and synergizes with dacarbazine.
21122381 2010 [Expression and significance of JNK1, Raf-1 and Livin in the carcinogenesis of sporadic colorectal tubular adenoma].
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20868603 2010 [Expressions of Raf-1 kinase, phosphorylated mitogen extracellular kinase 1, and phosphorylated extracellular signal-regulated protein kinase 1/2 in hepatocellular carcinoma and their relationship with prognosis].
20802526 2010 K-Ras4B phosphorylation at Ser181 is inhibited by calmodulin and modulates K-Ras activity and function.
20688353 2010 Reduced expression of Raf-1 kinase inhibitory protein is a significant prognostic marker in patients with gallbladder carcinoma.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20683980 2010 Noonan syndrome associated with both a new Jnk-activating familial SOS1 and a de novo RAF1 mutations.
20679480 2010 Impaired binding of 14-3-3 to C-RAF in Noonan syndrome suggests new approaches in diseases with increased Ras signaling.
20674547 2010 RAF protein-serine/threonine kinases: structure and regulation.
20630999 2010 Involvement of RAGE, NADPH oxidase, and Ras/Raf-1 pathway in glycated LDL-induced expression of heat shock factor-1 and plasminogen activator inhibitor-1 in vascular endothelial cells.
20543023 2010 The language phenotype of children and adolescents with Noonan syndrome.
20489206 2010 Leukotriene B(4) BLT receptor signaling regulates the level and stability of cyclooxygenase-2 (COX-2) mRNA through restricted activation of Ras/Raf/ERK/p42 AUF1 pathway.
20389169 2010 Decreased expression of FGFR1, SOS1, RAF1 genes in cryptorchidism.
20372086 2010 Dominant roles of the Raf/MEK/ERK pathway in cell cycle progression, prevention of apoptosis and sensitivity to chemotherapeutic drugs.
20302979 Investigation of gene dosage imbalances in patients with Noonan syndrome using multiplex ligation-dependent probe amplification analysis.
20234004 2010 A loss-of-function screen reveals Ras- and Raf-independent MEK-ERK signaling during Chlamydia trachomatis infection.
20230813 2010 The CRAL/TRIO and GOLD domain protein TAP-1 regulates RAF-1 activation.
20179103 2010 Active Mek2 as a regulatory scaffold that promotes Pin1 binding to BPGAP1 to suppress BPGAP1-induced acute Erk activation and cell migration.
20178605 2010 Genetic and functional characterization of putative Ras/Raf interaction inhibitors in C. elegans and mammalian cells.
20141835 2010 Kinase-dead BRAF and oncogenic RAS cooperate to drive tumor progression through CRAF.
20086174 2010 Proapoptotic kinase MST2 coordinates signaling crosstalk between RASSF1A, Raf-1, and Akt.
20071468 2010 Ras and calcium signaling pathways converge at Raf1 via the Shoc2 scaffold protein.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20052757 2010 Molecular and clinical analysis of RAF1 in Noonan syndrome and related disorders: dephosphorylation of serine 259 as the essential mechanism for mutant activation.
19953625 2010 Tumor spectrum in children with Noonan syndrome and SOS1 or RAF1 mutations.
19917255 2009 C-Raf inhibits MAPK activation and transformation by B-Raf(V600E).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895838 2010 Can BAD pores be good? New insights from examining BAD as a target of RAF kinases.
19881545 2010 BAG-1 overexpression attenuates luminal apoptosis in MCF-10A mammary epithelial cells through enhanced RAF-1 activation.
19825990 2009 A short hairpin DNA analogous to miR-125b inhibits C-Raf expression, proliferation, and survival of breast cancer cells.
19812696 2009 Cancer genomics identifies regulatory gene networks associated with the transition from dysplasia to advanced lung adenocarcinomas induced by c-Raf-1.
19802003 2010 c-Kit mutants require hypoxia-inducible factor 1alpha to transform melanocytes.
19801192 2009 Ras classical effectors: new tales from in silico complexes.
19737955 2009 C-Raf is associated with disease progression and cell proliferation in a subset of melanomas.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19718030 2009 Carbohydrate-specific signaling through the DC-SIGN signalosome tailors immunity to Mycobacterium tuberculosis, HIV-1 and Helicobacter pylori.
19710016 2009 Diacylglycerol kinase eta augments C-Raf activity and B-Raf/C-Raf heterodimerization.
19696784 2009 Nucleocytoplasmic transport of Alp7/TACC organizes spatiotemporal microtubule formation in fission yeast.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667065 2009 Identification of novel in vivo phosphorylation sites of the human proapoptotic protein BAD: pore-forming activity of BAD is regulated by phosphorylation.
19638615 2009 Cell type-specific importance of ras-c-raf complex association rate constants for MAPK signaling.
19638574 2009 Sorafenib inhibits non-small cell lung cancer cell growth by targeting B-RAF in KRAS wild-type cells and C-RAF in KRAS mutant cells.
19633425 2009 Sorafenib induces growth inhibition and apoptosis in human synovial sarcoma cells via inhibiting the RAF/MEK/ERK signaling pathway.
19595761 2009 The C-terminus of Raf-1 acts as a 14-3-3-dependent activation switch.
19492075 2009 Combined targeting of BRAF and CRAF or BRAF and PI3K effector pathways is required for efficacy in NRAS mutant tumors.
19380724 2009 Epithelial sodium channel regulated by differential composition of a signaling complex.
19363522 2009 Oncogenic RAF1 rearrangement and a novel BRAF mutation as alternatives to KIAA1549:BRAF fusion in activating the MAPK pathway in pilocytic astrocytoma.
19357705 2009 Loss of RAF kinase inhibitor protein is a somatic event in the pathogenesis of therapy-related acute myeloid leukemias with C-RAF germline mutations.
19298812 2009 Retinoic acid induces nuclear accumulation of Raf1 during differentiation of HL-60 cells.
19222999 2009 Reassessment of the role of FKBP38 in the Rheb/mTORC1 pathway.
19206169 2009 Germline BRAF mutations in Noonan, LEOPARD, and cardiofaciocutaneous syndromes: molecular diversity and associated phenotypic spectrum.
19197339 2009 Regulation of human myoblast differentiation by PEBP4.
19133693 2009 Cognitive profile of disorders associated with dysregulation of the RAS/MAPK signaling cascade.
19122653 2009 Dectin-1 directs T helper cell differentiation by controlling noncanonical NF-kappaB activation through Raf-1 and Syk.
19063885 2009 Regulation of growth and survival of activated T cells by cell-transducing inhibitors of Ras.
19058874 2009 Akt regulates vitamin D3-induced leukemia cell functional differentiation via Raf/MEK/ERK MAPK signaling.
19049963 2009 Regulation of RAF activity by 14-3-3 proteins: RAF kinases associate functionally with both homo- and heterodimeric forms of 14-3-3 proteins.
19047752 2008 Host alpha-adducin is redistributed and localized to the inclusion membrane in chlamydia- and chlamydophila-infected cells.
19037990 2009 RAF may induce cell proliferation through hypermethylation of tumor suppressor gene promoter in gastric epithelial cells.
19020799 2008 PTPN11, SOS1, KRAS, and RAF1 gene analysis, and genotype-phenotype correlation in Korean patients with Noonan syndrome.
19011619 2008 X-linked and cellular IAPs modulate the stability of C-RAF kinase and cell motility.
19001375 2009 How does arrestin assemble MAPKs into a signaling complex?
18952605 2008 Role of phosphatidic acid in the coupling of the ERK cascade.
18794803 2009 CRAF inhibition induces apoptosis in melanoma cells with non-V600E BRAF mutations.
18715846 2008 Morphoproteomic profile of mTOR, Ras/Raf kinase/ERK, and NF-kappaB pathways in human gastric adenocarcinoma.
18708364 2008 Cross-talk between aryl hydrocarbon receptor and mitogen-activated protein kinase signaling pathway in liver cancer through c-raf transcriptional regulation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18592002 2008 RAS signaling in colorectal carcinomas through alteration of RAS, RAF, NF1, and/or RASSF1A.
18483265 2008 A small molecule disruptor of Rb/Raf-1 interaction inhibits cell proliferation, angiogenesis, and growth of human tumor xenografts in nude mice.
18472967 2008 Constitutive activation of Raf-1 induces glioma formation in mice.
18465753 2008 p21 activated kinase 5 activates Raf-1 and targets it to mitochondria.
18356164 2008 Isoform-specific interaction of C-RAF with mitochondria.
18316782 2008 Site-specific phosphorylation of raf in cells containing oncogenic ras-p21 is likely mediated by jun-N-terminal kinase.
18294816 2008 The RKIP (Raf-1 Kinase Inhibitor Protein) conserved pocket binds to the phosphorylated N-region of Raf-1 and inhibits the Raf-1-mediated activated phosphorylation of MEK.
18273062 2008 A novel switch region regulates H-ras membrane orientation and signal output.
18241070 2008 Genotype-phenotype analysis and natural history of left ventricular hypertrophy in LEOPARD syndrome.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18182859 2007 Low-dose radiation stimulates the proliferation of normal human lung fibroblasts via a transient activation of Raf and Akt.
18064632 2008 GRP78 and Raf-1 cooperatively confer resistance to endoplasmic reticulum stress-induced apoptosis.
18022816 2008 Glutamate accelerates RPE cell proliferation through ERK1/2 activation via distinct receptor-specific mechanisms.
18006502 2008 Inhibition of Raf-1 alters multiple downstream pathways to induce pancreatic beta-cell apoptosis.
17998336 2008 The SH3 domain of Lck modulates T-cell receptor-dependent activation of extracellular signal-regulated kinase through activation of Raf-1.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17889508 2008 Gastrin transactivates the chromogranin A gene through MEK-1/ERK- and PKC-dependent phosphorylation of Sp1 and CREB.
17724343 2007 Spatial regulation of Raf kinase signaling by RKTG.
17635919 2007 B- and C-RAF display essential differences in their binding to Ras: the isotype-specific N terminus of B-RAF facilitates Ras binding.
17614099 Overexpression of human Raf-1 enhances radiosensitivity in fission yeast, Schizosaccharomyces pombe.
17603483 2007 Gain-of-function RAF1 mutations cause Noonan and LEOPARD syndromes with hypertrophic cardiomyopathy.
17603482 2007 Germline gain-of-function mutations in RAF1 cause Noonan syndrome.
17572489 2007 RAF-1 over-expression does condition survival of patients affected by aggressive mantle cell lymphoma.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17462920 2007 C-type lectin DC-SIGN modulates Toll-like receptor signaling via Raf-1 kinase-dependent acetylation of transcription factor NF-kappaB.
17428866 2007 Hepatitis B virus X protein stimulates the mitochondrial translocation of Raf-1 via oxidative stress.
17397260 2007 Systematic identification of cellular signals reactivating Kaposi sarcoma-associated herpesvirus.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17332776 2007 C-Raf antagonizes apoptosis induced by IFN-alpha in human lung cancer cells by phosphorylation and increase of the intracellular content of elongation factor 1A.
17277048 2007 Raf-1 kinase mediates adenylyl cyclase sensitization by TNF-alpha in human airway smooth muscle cells.
17243098 2007 Human Raf-1 proteins associate with Rad24 and Cdc25 in cell-cycle checkpoint pathway of fission yeast, Schizosaccharomyces pombe.
17218791 2007 Phosphatase and feedback regulation of Raf-1 signaling.
17097642 2006 Regulation of RKIP binding to the N-region of the Raf-1 kinase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17064357 2006 Distribution, levels and phosphorylation of Raf-1 in Alzheimer's disease.
17018604 2006 In melanoma, RAS mutations are accompanied by switching signaling from BRAF to CRAF and disrupted cyclic AMP signaling.
16964381 2006 Interaction and stabilization of X-linked inhibitor of apoptosis by Raf-1 protein kinase.
16924233 2007 Raf 1 represses expression of the tight junction protein occludin via activation of the zinc-finger transcription factor slug.
16909118 2007 Oncogenic tyrosine kinase NPM/ALK induces activation of the MEK/ERK signaling pathway independently of c-Raf.
16892053 2006 Regulation of the Raf-MEK-ERK pathway by protein phosphatase 5.
16883571 2006 Raf-1 signaling is required for the later stages of 1,25-dihydroxyvitamin D3-induced differentiation of HL60 cells but is not mediated by the MEK/ERK module.
16862215 2006 Nicotine induces cell proliferation by beta-arrestin-mediated activation of Src and Rb-Raf-1 pathways.
16837009 2006 A dimeric kinase assembly underlying autophosphorylation in the p21 activated kinases.
16803888 2006 Rheb inhibits C-raf activity and B-raf/C-raf heterodimerization.
16707572 2006 Three-dimensional culture regulates Raf-1 expression to modulate fibronectin matrix assembly.
16649144 2006 Back to the roots: the remarkable RAF oncogene story.
16630891 2006 A phosphatase holoenzyme comprised of Shoc2/Sur8 and the catalytic subunit of PP1 functions as an M-Ras effector to modulate Raf activity.
16575407 2006 Activation of Ras/Raf protects cells from melanoma differentiation-associated gene-5-induced apoptosis.
16569214 2006 Neuronal nitric oxide synthase-induced S-nitrosylation of H-Ras inhibits calcium ionophore-mediated extracellular-signal-regulated kinase activity.
16565089 2006 Hyaluronan-CD44 interaction with leukemia-associated RhoGEF and epidermal growth factor receptor promotes Rho/Ras co-activation, phospholipase C epsilon-Ca2+ signaling, and cytoskeleton modification in head and neck squamous cell carcinoma cells.
16537381 2006 Mixed-lineage kinase 3 regulates B-Raf through maintenance of the B-Raf/Raf-1 complex and inhibition by the NF2 tumor suppressor protein.
16508002 2006 Regulation and role of Raf-1/B-Raf heterodimerization.
16465392 2006 Gene expression profile by inhibiting Raf-1 protein kinase in breast cancer cells.
16413928 2006 14-3-3zeta interacts with human thromboxane receptors and is involved in the agonist-induced activation of the extracellular-signal-regulated kinase.
16405965 2006 Raf-1 kinase associates with Hepatitis C virus NS5A and regulates viral replication.
16364920 2005 Wild-type and mutant B-RAF activate C-RAF through distinct mechanisms involving heterodimerization.
16332724 2006 Raf-1 is the predominant Raf isoform that mediates growth factor-stimulated growth in ovarian cancer cells.
16330544 2006 Chaperoning checkpoint kinase 1 (Chk1), an Hsp90 client, with purified chaperones.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
16301319 2006 Erbin inhibits RAF activation by disrupting the sur-8-Ras-Raf complex.
16266749 2006 Collagen type I-mediated activation of ERK/MAP Kinase is dependent on Ras, Raf-1 and protein phosphatase 2A in Jurkat T cells.
16239230 2005 Positive regulation of Raf1-MEK1/2-ERK1/2 signaling by protein serine/threonine phosphatase 2A holoenzymes.
16172610 2006 ERK MAP kinase signaling in post-mortem brain of suicide subjects: differential regulation of upstream Raf kinases Raf-1 and B-Raf.
16093354 2005 Identification of Raf-1 S471 as a novel phosphorylation site critical for Raf-1 and B-Raf kinase activities and for MEK binding.
16086581 2005 Functional interactions of Raf and MEK with Jun-N-terminal kinase (JNK) result in a positive feedback loop on the oncogenic Ras signaling pathway.
16029117 2005 Medullary thyroid cancer: the functions of raf-1 and human achaete-scute homologue-1.
16009725 2005 CAPRI and RASAL impose different modes of information processing on Ras due to contrasting temporal filtering of Ca2+.
15943972 2005 Second nature: biological functions of the Raf-1 "kinase".
15935327 2005 Raf-1 is a binding partner of DSCR1.
15925322 2005 Apoptosis-linked gene-2 connects the Raf-1 and ASK1 signalings.
15899852 2005 Raf-1 serine 338 phosphorylation plays a key role in adhesion-dependent activation of extracellular signal-regulated kinase by epidermal growth factor.
15849194 2005 p21-activated Kinase 1 (Pak1)-dependent phosphorylation of Raf-1 regulates its mitochondrial localization, phosphorylation of BAD, and Bcl-2 association.
15845549 2005 CNK1 is a scaffold protein that regulates Src-mediated Raf-1 activation.
15778465 2005 Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer.
15711535 2005 Ras binding opens c-Raf to expose the docking site for mitogen-activated protein kinase kinase.
15710605 2005 B-Raf and Raf-1 are regulated by distinct autoregulatory mechanisms.
15688026 2005 Cooperation and selectivity of the two Grb2 binding sites of p52Shc in T-cell antigen receptor signaling to Ras family GTPases and Myc-dependent survival.
15674327 2005 Apoptosis of hematopoietic cells induced by growth factor withdrawal is associated with caspase-9 mediated cleavage of Raf-1.
15666389 2005 Raf-1 expression may influence progression to androgen insensitive prostate cancer.
15664191 2005 Regulation of Raf-1 by direct feedback phosphorylation.
15662129 2005 Inhibition of gastric cancer angiogenesis by vector-based RNA interference for Raf-1.
15657590 2004 Insulin-like growth factor 1 signaling in human gastrointestinal carcinoid tumor cells.
15653554 2005 Elastin peptides activate extracellular signal-regulated kinase 1/2 via a Ras-independent mechanism requiring both p110gamma/Raf-1 and protein kinase A/B-Raf signaling in human skin fibroblasts.
15618521 2004 Role of the kinase MST2 in suppression of apoptosis by the proto-oncogene product Raf-1.
15591313 2005 Location and functional significance of retinol-binding sites on the serine/threonine kinase, c-Raf.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485920 2004 Disruption of the Rb--Raf-1 interaction inhibits tumor growth and angiogenesis.
15470083 2005 Protein kinase C and epidermal growth factor stimulation of Raf1 potentiates adenylyl cyclase type 6 activation in intact cells.
15451031 2005 Activation of Raf1 and the ERK pathway in response to l-ascorbic acid in acute myeloid leukemia cells.
15385642 2004 Raf kinase activation of adenylyl cyclases: isoform-selective regulation.
15314064 2004 Raf-1 activation disrupts its binding to keratins during cell stress.
15302887 2004 A novel human phosphatidylethanolamine-binding protein resists tumor necrosis factor alpha-induced apoptosis by inhibiting mitogen-activated protein kinase pathway activation and phosphatidylethanolamine externalization.
15211515 2004 Change in protein flexibility upon complex formation: analysis of Ras-Raf using molecular dynamics and a molecular framework approach.
15122343 2004 Raf promotes human herpesvirus-8 (HHV-8/KSHV) infection.
15075335 2004 The scaffold protein CNK1 interacts with the tumor suppressor RASSF1A and augments RASSF1A-induced cell death.
15067053 2004 STAT5 activation underlies IL7 receptor-dependent B cell development.
15047712 2004 LGI1, a putative tumor metastasis suppressor gene, controls in vitro invasiveness and expression of matrix metalloproteinases in glioma cells through the ERK1/2 pathway.
15041731 2004 Antisense oligonucleotide targeting of Raf-1: importance of raf-1 mRNA expression levels and raf-1-dependent signaling in determining growth response in ovarian cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688280 2004 Dynamic changes in C-Raf phosphorylation and 14-3-3 protein binding in response to growth factor stimulation: differential roles of 14-3-3 protein binding sites.
14688025 2004 Mutation analysis of the BRAF, ARAF and RAF-1 genes in human colorectal adenocarcinomas.
14623285 2003 The synergistic activation of Raf-1 kinase by phorbol myristate acetate and hydrogen peroxide in NIH3T3 cells.
12975377 2003 Identification of a novel human kinase supporter of Ras (hKSR-2) that functions as a negative regulator of Cot (Tpl2) signaling.
12954639 2003 Calcium/calmodulin-dependent protein kinase II binds to Raf-1 and modulates integrin-stimulated ERK activation.
12925535 2003 Functional analysis of a phosphatidic acid binding domain in human Raf-1 kinase: mutations in the phosphatidate binding domain lead to tail and trunk abnormalities in developing zebrafish embryos.
12865432 2003 Regulation of Raf through phosphorylation and N terminus-C terminus interaction.
12851216 2003 Raf-1 activation suppresses neuroendocrine marker and hormone levels in human gastrointestinal carcinoid cells.
12843393 2003 Role of Raf in vascular protection from distinct apoptotic stimuli.
12717443 2003 Mammalian Sprouty4 suppresses Ras-independent ERK activation by binding to Raf1.
12691824 2003 Down-regulation of Raf-1 kinase is associated with paclitaxel resistance in human breast cancer MCF-7/Adr cells.
12682854 2003 1,25-dihydroxyvitamin D(3) increases human cystatin A expression by inhibiting the Raf-1/MEK1/ERK signaling pathway of keratinocytes.
12663662 2003 Fibroblast quiescence in floating collagen matrices: decrease in serum activation of MEK and Raf but not Ras.
12626521 2003 Serine 338 phosphorylation is dispensable for activation of c-Raf1.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12551923 2003 Phosphorylation of Raf-1 by p21-activated kinase 1 and Src regulates Raf-1 autoinhibition.
12490852 2002 Activation of the ras/raf-1 signal transduction pathway in carcinoid tumor cells results in morphologic transdifferentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429936 Raf-induced cell cycle progression in human TF-1 hematopoietic cells.
12391160 2002 Glucocorticoid-induced leucine zipper inhibits the Raf-extracellular signal-regulated kinase pathway by binding to Raf-1.
12374792 2003 Usage of tautomycetin, a novel inhibitor of protein phosphatase 1 (PP1), reveals that PP1 is a positive regulator of Raf-1 in vivo.
12360521 2002 Role of the 14-3-3 C-terminal loop in ligand interaction.
12244094 2002 Phosphorylation of 338SSYY341 regulates specific interaction between Raf-1 and MEK1.
12237340 2002 Activation of the mitogen activated protein kinase extracellular signal-regulated kinase 1 and 2 by the nitric oxide-cGMP-cGMP-dependent protein kinase axis regulates the expression of matrix metalloproteinase 13 in vascular endothelial cells.
12194967 2002 Di-Ras, a distinct subgroup of ras family GTPases with unique biochemical properties.
12127063 2002 Untying the regulation of the Raf-1 kinase.
12087097 2002 Inhibition of phosphorylation of BAD and Raf-1 by Akt sensitizes human ovarian cancer cells to paclitaxel.
11997508 2002 Cyclic AMP blocks cell growth through Raf-1-dependent and Raf-1-independent mechanisms.
11971957 2002 Cyclic AMP-dependent kinase regulates Raf-1 kinase mainly by phosphorylation of serine 259.
11948406 2002 PAK1 primes MEK1 for phosphorylation by Raf-1 kinase during cross-cascade activation of the ERK pathway.
11909642 2002 Identification of interaction between MEK2 and A-Raf-1.
11853019 2002 Decreased expression of hippocampal cholinergic neurostimulating peptide precursor protein mRNA in the hippocampus in Alzheimer disease.
11788587 2002 Involvement of phosphatidylinositol 3-kinase, but not RalGDS, in TC21/R-Ras2-mediated transformation.
11784866 2002 The RAS effector RIN1 directly competes with RAF and is regulated by 14-3-3 proteins.
11756411 2002 Dephosphorylation of Ser-259 regulates Raf-1 membrane association.
11751906 2002 The role of Hsp90N, a new member of the Hsp90 family, in signal transduction and neoplastic transformation.
11733498 2002 Interaction between active Pak1 and Raf-1 is necessary for phosphorylation and activation of Raf-1.
11719507 2002 Phosphorylation of the myosin-binding subunit of myosin phosphatase by Raf-1 and inhibition of phosphatase activity.
11697890 2001 Functional conservation of 14-3-3 isoforms in inhibiting bad-induced apoptosis.
11604401 2001 Identification of a C-terminal region that regulates mitogen-activated protein kinase kinase-1 cytoplasmic localization and ERK activation.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11447113 2001 Positive and negative regulation of Raf kinase activity and function by phosphorylation.
11427728 2001 Raf-1 promotes cell survival by antagonizing apoptosis signal-regulating kinase 1 through a MEK-ERK independent mechanism.
11409918 2000 Complexes formation between insulin receptor and extracellular signal-regulated kinases ERKs.
11350735 2001 Inhibitory actions of ceramide upon PKC-epsilon/ERK interactions.
11325826 2001 Active Ras induces heterodimerization of cRaf and BRaf.
11306563 2001 Cloning and characterization of MST4, a novel Ste20-like kinase.
11226259 2001 Activation and targeting of extracellular signal-regulated kinases by beta-arrestin scaffolds.
11171046 2001 Vascular endothelial growth factor-induced prostacyclin production is mediated by a protein kinase C (PKC)-dependent activation of extracellular signal-regulated protein kinases 1 and 2 involving PKC-delta and by mobilization of intracellular Ca2+.
11044439 2000 A scaffold protein in the c-Jun NH2-terminal kinase signaling pathways suppresses the extracellular signal-regulated kinase signaling pathways.
11005817 2000 Glucocorticoid receptor interaction with 14-3-3 and Raf-1, a proposed mechanism for cross-talk of two signal transduction pathways.
10969079 2000 MEKK1 binds raf-1 and the ERK2 cascade components.
10887173 2000 Calyculin A-induced vimentin phosphorylation sequesters 14-3-3 and displaces other 14-3-3 partners in vivo.
10869570 2000 Rac-1 and Raf-1 kinases, components of distinct signaling pathways, activate myotonic dystrophy protein kinase.
10837247 2000 The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.
10801873 2000 Raf-1-associated protein phosphatase 2A as a positive regulator of kinase activation.
10783161 2000 The leucine-rich repeat protein SUR-8 enhances MAP kinase activation and forms a complex with Ras and Raf.
10712923 2000 The Ras branch of small GTPases: Ras family members don't fall far from the tree.
10644344 2000 Hepatitis C virus core protein interacts with 14-3-3 protein and activates the kinase Raf-1.
10620507 2000 14-3-3 isotypes facilitate coupling of protein kinase C-zeta to Raf-1: negative regulation by 14-3-3 phosphorylation.
10585452 1999 Localization of endogenous Grb10 to the mitochondria and its interaction with the mitochondrial-associated Raf-1 pool.
10576742 1999 Phosphorylation and regulation of Raf by Akt (protein kinase B).
10531364 1999 Contribution of the ERK5/MEK5 pathway to Ras/Raf signaling and growth control.
10523642 1999 JSAP1, a novel jun N-terminal protein kinase (JNK)-binding protein that functions as a Scaffold factor in the JNK signaling pathway.
10523633 1999 Rb and prohibitin target distinct regions of E2F1 for repression and respond to different upstream signals.
10498616 1999 M-Ras, a widely expressed 29-kD homologue of p21 Ras: expression of a constitutively active mutant results in factor-independent growth of an interleukin-3-dependent cell line.
10497893 1999 Mutational analysis of Raf-1 cysteine rich domain: requirement for a cluster of basic aminoacids for interaction with phosphatidylserine.
10486249 1999 Direct interaction of p21 cyclin-dependent kinase inhibitor with the retinoblastoma tumor suppressor protein.
10454553 1999 The strength of interaction at the Raf cysteine-rich domain is a critical determinant of response of Raf to Ras family small GTPases.
10433554 1999 14-3-3Gamma interacts with and is phosphorylated by multiple protein kinase C isoforms in PDGF-stimulated human vascular smooth muscle cells.
10373531 1999 Tyrosine phosphorylation of the proto-oncoprotein Raf-1 is regulated by Raf-1 itself and the phosphatase Cdc25A.
10329666 1999 The ankyrin repeat-containing adaptor protein Tvl-1 is a novel substrate and regulator of Raf-1.
10205168 1999 Serine and tyrosine phosphorylations cooperate in Raf-1, but not B-Raf activation.
10064593 1999 Activation of the Raf/MAP kinase cascade by the Ras-related protein TC21 is required for the TC21-mediated transformation of NIH 3T3 cells.
9867809 1999 Effect of phosphorylation on activities of Rap1A to interact with Raf-1 and to suppress Ras-dependent Raf-1 activation.
9823899 1998 The protein kinase Pak3 positively regulates Raf-1 activity through phosphorylation of serine 338.
9819434 1998 Raf-1 physically interacts with Rb and regulates its function: a link between mitogenic signaling and cell cycle regulation.
9765203 1998 Premature senescence involving p53 and p16 is activated in response to constitutive MEK/MAPK mitogenic signaling.
9710607 1998 14-3-3 proteins are required for maintenance of Raf-1 phosphorylation and kinase activity.
9689060 1998 Autoregulation of the Raf-1 serine/threonine kinase.
9671314 1998 Activation of the 41/43 kDa mitogen-activated protein kinase signaling pathway is required for hepatocyte growth factor-induced cell scattering.
9624170 1998 Binding of c-Raf1 kinase to a conserved acidic sequence within the carboxyl-terminal region of the HIV-1 Nef protein.
9553107 1998 Interaction of the Grb10 adapter protein with the Raf1 and MEK1 kinases.
9523700 1998 Identification of a specific effector of the small GTP-binding protein Rap2.
9488663 1998 Identification of Nore1 as a potential Ras effector.
9446616 1998 Interferon gamma activation of Raf-1 is Jak1-dependent and p21ras-independent.
9360956 1997 14-3-3 is phosphorylated by casein kinase I on residue 233. Phosphorylation at this site in vivo regulates Raf/14-3-3 interaction.
9315742 1997 c-Raf kinase binds to N-terminal domain of c-Myc.
9234708 1997 Phosphorylation of Raf-1 serine 338-serine 339 is an essential regulatory event for Ras-dependent activation and biological signaling.
9230211 1997 Activation of CDC 25 phosphatase and CDC 2 kinase involved in GL331-induced apoptosis.
9153224 1997 Raf-1 kinase and exoenzyme S interact with 14-3-3zeta through a common site involving lysine 49.
9144171 1997 Protein binding and signaling properties of RIN1 suggest a unique effector function.
9115221 1997 Coassociation of Rap1A and Ha-Ras with Raf-1 N-terminal region interferes with ras-dependent activation of Raf-1.
9099670 1997 Physical association with ras enhances activation of membrane-bound raf (RafCAAX).
9091312 1997 Identification of Raf-1 Ser621 kinase activity from NIH 3T3 cells as AMP-activated protein kinase.
9069267 1997 Signal transduction by the neurotrophin receptors.
9069260 1997 The complexity of Raf-1 regulation.
9001246 1997 Rheb interacts with Raf-1 kinase and may function to integrate growth factor- and protein kinase A-dependent signals.
8939988 1996 Activation of T cell Raf-1 at mitosis requires the protein-tyrosine kinase Lck.
8929532 1996 Bcl-2 targets the protein kinase Raf-1 to mitochondria.
8929531 1996 Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L)
8911690 1996 Loss of Raf-1-binding activity of v-Ha-Ras by the deletion of amino acid residues 64-72 and 143-151.
8910675 1996 Structure-function analysis of Bcl-2 family proteins. Regulators of programmed cell death.
8900182 1996 Association of a p95 Vav-containing signaling complex with the FcepsilonRI gamma chain in the RBL-2H3 mast cell line. Evidence for a constitutive in vivo association of Vav with Grb2, Raf-1, and ERK2 in an active complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8876196 1996 The cytokine-activated tyrosine kinase JAK2 activates Raf-1 in a p21ras-dependent manner.
8816460 1996 Increased expression of the Ras suppressor Rsu-1 enhances Erk-2 activation and inhibits Jun kinase activation.
8756332 1996 Ras/Rap effector specificity determined by charge reversal.
8753867 1996 Regulation of neuromodulatory actions of angiotensin II in the brain neurons by the Ras-dependent mitogen-activated protein kinase pathway.
8710867 1996 The solution structure of the Raf-1 cysteine-rich domain: a novel ras and phospholipid binding site.
8702721 1996 14-3-3 proteins associate with A20 in an isoform-specific manner and function both as chaperone and adapter molecules.
8692945 1996 Bcl-2 interacting protein, BAG-1, binds to and activates the kinase Raf-1.
8670882 1996 Identification of a novel Rac1-interacting protein involved in membrane ruffling.
8621729 1996 Selective activation of MEK1 but not MEK2 by A-Raf from epidermal growth factor-stimulated Hela cells.
8601312 1996 Interaction of 14-3-3 with signaling proteins is mediated by the recognition of phosphoserine.
8530446 1995 Cysteine-rich region of Raf-1 interacts with activator domain of post-translationally modified Ha-Ras.
8408024 1993 Raf exists in a native heterocomplex with hsp90 and p50 that can be reconstituted in a cell-free system.
8394352 1993 Activation of mitogen-activated protein kinase/extracellular signal-regulated kinase kinase by G protein and tyrosine kinase oncoproteins.
8393135 1993 Identification and characterization of a new mammalian mitogen-activated protein kinase kinase, MKK2.
8349631 1993 Receptor accessory factor enhances specific DNA binding of androgen and glucocorticoid receptors.
8349614 1993 Identification of the major phosphorylation sites of the Raf-1 kinase.
8332195 1993 Direct interaction of Ras and the amino-terminal region of Raf-1 in vitro.
8332187 1993 Normal and oncogenic p21ras proteins bind to the amino-terminal regulatory domain of c-Raf-1.
8321321 1993 Protein kinase C alpha activates RAF-1 by direct phosphorylation.
8157000 1994 Identification of the sites in MAP kinase kinase-1 phosphorylated by p74raf-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8085158 1994 Binding of 14-3-3 proteins to the protein kinase Raf and effects on its activation.
8084603 1994 Human ltk receptor tyrosine kinase binds to PLC-gamma 1, PI3-K, GAP and Raf-1 in vivo.
8063729 1994 Signaling through transforming G protein-coupled receptors in NIH 3T3 cells involves c-Raf activation. Evidence for a protein kinase C-independent pathway.
8035810 1994 Critical binding and regulatory interactions between Ras and Raf occur through a small, stable N-terminal domain of Raf and specific Ras effector residues.
7939632 1994 Interaction of the protein kinase Raf-1 with 14-3-3 proteins.
7935795 1994 Activation of Raf-1 by 14-3-3 proteins.
7882972 1995 Regulation of Raf-1 kinase activity by the 14-3-3 family of proteins.
7791872 1995 The 2.2 A crystal structure of the Ras-binding domain of the serine/threonine kinase c-Raf1 in complex with Rap1A and a GTP analogue.
7782277 1995 A direct interaction between G-protein beta gamma subunits and the Raf-1 protein kinase.
7766599 1995 Solution structure of the Ras-binding domain of c-Raf-1 and identification of its Ras interaction surface.
7760835 1995 14-3-3 is not essential for Raf-1 function: identification of Raf-1 proteins that are biologically activated in a 14-3-3- and Ras-independent manner.
7731720 1995 B-Raf protein isoforms interact with and phosphorylate Mek-1 on serine residues 218 and 222.
7730360 1995 Two distinct Raf domains mediate interaction with Ras.
7644510 1995 14-3-3 proteins associate with cdc25 phosphatases.
7628630 1995 Characterization of the interaction of Raf-1 with ras p21 or 14-3-3 protein in intact cells.
7517401 1994 Raf-1 interacts with Fyn and Src in a non-phosphotyrosine-dependent manner.
7477354 1995 Phosphorylation of Raf by ceramide-activated protein kinase.
3616625 1987 The raf oncogene is associated with a radiation-resistant human laryngeal cancer.
3003687 1986 The complete coding sequence of the human raf oncogene and the corresponding structure of the c-raf-1 gene.
2993863 1985 Structure and biological activity of human homologs of the raf/mil oncogene.
2955285 1987 Activation of human c-raf-1 by replacing the N-terminal region with different sequences.
2475255 1989 Direct activation of the serine/threonine kinase activity of Raf-1 through tyrosine phosphorylation by the PDGF beta-receptor.
1886707 1991 An alternatively spliced c-mil/raf mRNA is predominantly expressed in chicken muscular tissues and conserved among vertebrate species.
1846778 1991 Raf-1: a kinase currently without a cause but not lacking in effects.
1639773 1992 Interleukin-2 (IL-2) induces tyrosine kinase-dependent translocation of active raf-1 from the IL-2 receptor into the cytosol.
1612588 1992 A genetic linkage map of 96 loci on the short arm of human chromosome 3.
1611909 1992 Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23.