Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.37
PubTator Score 6.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.2e-86

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 2.2e-86

Gene RIF (8)

PMID Text
25212604 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20304922 RAET1G is regulated post-translationally to produce a GPI-anchored isoform
20219610 Observational study of genotype prevalence. (HuGE Navigator)
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19424970 RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold.
19223974 the expression patterns of ULBP5RAET1G are very similar to the well-characterised NKG2D ligand, MICA. However the two isoforms of ULBP5/RAET1G have very different cellular localisations that are likely to reflect unique functionality.
15240696 Binds the activating receptor NKG2D and the the human cytomegalovirus protein UL16.

AA Sequence

MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQ     71 - 140
LSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAG    141 - 210
APPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSD    211 - 280
SYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS                    281 - 334
//

Text Mined References (21)

PMID Year Title
26041808 2015 NKG2D Receptor and Its Ligands in Host Defense.
25510288 2014 MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer.
25473094 2015 Immunohistochemical validation and expression profiling of NKG2D ligands in a wide spectrum of human epithelial neoplasms.
25212604 2014 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
23298206 2013 Regulation of ligands for the NKG2D activating receptor.
20522206 2010 Linkage disequilibrium of polymorphic RAET1 genes in Thais.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20304922 2010 Post-translational modification of the NKG2D ligand RAET1G leads to cell surface expression of a glycosylphosphatidylinositol-linked isoform.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
19861434 2009 NKG2D ligand expression in human colorectal cancer reveals associations with prognosis and evidence for immunoediting.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
19658097 2009 ULBP6/RAET1L is an additional human NKG2D ligand.
19424970 2009 Differential NKG2D binding to highly related human NKG2D ligands ULBP2 and RAET1G is determined by a single amino acid in the alpha2 domain.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19223974 2009 Cellular expression, trafficking, and function of two isoforms of human ULBP5/RAET1G.
18544572 2008 Four novel ULBP splice variants are ligands for human NKG2D.
17878262 2007 Induction of NKG2D ligands on human dendritic cells by TLR ligand stimulation and RNA virus infection.
15240696 2004 Two human ULBP/RAET1 molecules with transmembrane regions are ligands for NKG2D.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827464 2002 A cluster of ten novel MHC class I related genes on human chromosome 6q24.2-q25.3.