Property Summary

NCBI Gene PubMed Count 30
PubMed Score 53.74
PubTator Score 37.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.400 2.5e-04
group 3 medulloblastoma 1.100 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.800 5.0e-04
lung cancer 1.800 6.2e-03
non-small cell lung cancer 1.141 8.8e-19
osteosarcoma -1.328 8.3e-04

Protein-protein Interaction (5)

Gene RIF (15)

AA Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE      1 - 70
VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN     71 - 140
YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP    141 - 210
LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA    211 - 280
FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK    281 - 350
NYIFLRNAAEELKPRNKK                                                        351 - 368
//

Text Mined References (33)

PMID Year Title