Property Summary

NCBI Gene PubMed Count 26
PubMed Score 51.69
PubTator Score 37.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.328 8.3e-04
non-small cell lung cancer 1.141 8.8e-19
intraductal papillary-mucinous neoplasm ... 1.800 5.0e-04
lung cancer 1.900 1.3e-05
group 3 medulloblastoma 1.100 2.8e-03
dermatomyositis 1.400 2.5e-04

Synonym

Accession P78406 A8K882 O15306 Q3SYL7 Q5TCH8 Q6V708 Q9H100 Q9NQM6
Symbols MIG14
MRNP41
Mnrp41
dJ481F12.3
dJ800J21.1

Gene

PDB

3MMY   4OWR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (13)

PMID Text
24927547 Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 * Nup98).
23169621 mouse cytomegalovirus m152/gp40 interaction with RAE1gamma structural analysis reveals a paradigm for MHC/MHC interaction in immune evasion
23028327 vesicular stomatitis virus M protein interacted efficiently with Rae1-Nup98 complexes associated with the chromatin fraction of host nuclei, consistent with an effect on host transcription
22357847 This study established a novel postmitotic function for rae-1 in neuronal development.
21467841 RAE1 transgene orchestrates proper chromosome segregation and NUP98-mediated leukemogenesis.
20530257 In a transgenic mouse model of chronic natural killer NKG2D ligand expression, constant exposure to NKG2D ligand RNA export 1 homolog (Rae-1 epsilon) does not functionally impair NK cells or CD8-positive T cells in the context of viral infection.
20498086 present the crystal structure of human Rae1 in complex with the Gle2-binding sequence (GLEBS) of Nup98 at 1.65 A resolution. Rae1 forms a seven-bladed beta-propeller with several extensive surface loops.
20016259 Interaction between Rae1 and cohesin subunit SMC1 is required for proper spindle formation.
18212744 Retinoic acid downregulates Rae1 leading to APC(Cdh1) activation and neuroblastoma SH-SY5Y differentiation.
17172455 point to the Rae1-NuMA interaction as a critical element for normal spindle formation in mitosis
15851029 A purified Rae1 complex stabilizes microtubules in egg extracts in a RanGTP/importin beta-regulated manner
15629720 VSV M protein blocks mRNA export by disrupting Rae1 function, which can be reverted by induction of Rae1 expression.
11831386 These data show an association of mrnp41 with MT and, moreover, demonstrate that an intact MT system is necessary for dispersion of mrnp41-containing particles to the cellular periphery

AA Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE      1 - 70
VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN     71 - 140
YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP    141 - 210
LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA    211 - 280
FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK    281 - 350
NYIFLRNAAEELKPRNKK                                                        351 - 368
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24927547 2014 Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 • Nup98).
23169621 2012 Structural basis of mouse cytomegalovirus m152/gp40 interaction with RAE1? reveals a paradigm for MHC/MHC interaction in immune evasion.
23028327 2012 Complexes of vesicular stomatitis virus matrix protein with host Rae1 and Nup98 involved in inhibition of host transcription.
22357847 2012 RAE-1, a novel PHR binding protein, is required for axon termination and synapse formation in Caenorhabditis elegans.
21467841 2011 RNA export factor RAE1 contributes to NUP98-HOXA9-mediated leukemogenesis.
21269460 2011 Initial characterization of the human central proteome.
20530257 2010 Intact NKG2D-independent function of NK cells chronically stimulated with the NKG2D ligand Rae-1.
20498086 2010 Structural and functional analysis of the interaction between the nucleoporin Nup98 and the mRNA export factor Rae1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20016259 2010 Interaction between Rae1 and cohesin subunit SMC1 is required for proper spindle formation.
18212744 2008 Retinoic acid downregulates Rae1 leading to APC(Cdh1) activation and neuroblastoma SH-SY5Y differentiation.
17172455 2006 Rae1 interaction with NuMA is required for bipolar spindle formation.
15851029 2005 A Rae1-containing ribonucleoprotein complex is required for mitotic spindle assembly.
15629720 2005 VSV disrupts the Rae1/mrnp41 mRNA nuclear export pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11520456 2001 Molecular competition for NKG2D: H60 and RAE1 compete unequally for NKG2D with dominance of H60.
11352911 2001 The mitotic checkpoint protein hBUB3 and the mRNA export factor hRAE1 interact with GLE2p-binding sequence (GLEBS)-containing proteins.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10209021 1999 RAE1 is a shuttling mRNA export factor that binds to a GLEBS-like NUP98 motif at the nuclear pore complex through multiple domains.
9918853 1999 Identification and characterization of nuclear pore subcomplexes in mitotic extract of human somatic cells.
9370289 1997 The human RAE1 gene is a functional homologue of Schizosaccharomyces pombe rae1 gene involved in nuclear export of Poly(A)+ RNA.
9256445 1997 mRNA binding protein mrnp 41 localizes to both nucleus and cytoplasm.
8982867 1996 Genomic structures and characterization of Rae1 family members encoding GPI-anchored cell surface proteins and expressed predominantly in embryonic mouse brain.