Property Summary

NCBI Gene PubMed Count 37
PubMed Score 27.05
PubTator Score 20.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (19)

PMID Text
26431531 Patients with expression of both FEN1 and RAD54B were prone to have advanced nodal involvement and significantly poor prognosis.
26046797 RAD54B expression has potential to serve as a novel prognostic biomarker, particularly for distant recurrence in colorectal cancer
25765654 support a model in which RAD54L and RAD54B counteract genome-destabilizing effects of direct binding of RAD51 to dsDNA in tumor cells
25384516 The scaffolding function of Rad54B dynamically regulates the maintenance of genome integrity by limiting checkpoint strength.
24002644 RAD54B-deficient cells are selectively killed relative to controls via siRNA-based silencing of SOD1
23876972 RAD54B and GREB1 gene polymorphisms may not be associated with PCOS in the Han Chinese population.
20687897 These results suggest that hINO80 assists double-strand break repair by positively regulating the expression of the Rad54B and XRCC3 genes.
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19218431 RAD54B-deficient human colorectal cancer cells are sensitive to synthetic lethal killing by reduced FEN1 expression, while isogenic RAD54B proficient cells are not
19124506 Observational study of gene-disease association. (HuGE Navigator)
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18718930 RAD54B binding may affect the quaternary structure of DMC1.
18463164 S100A11 targets Rad54B to sites of DNA DSB repair sites and has a role in p21-based regulation of cell cycle
17585536 the loss of heterozygosity (LOH) in the 8q12-q24.1 chromosomal region, containing RAD54B gene isn't predictive for breast cancer
16945962 Rad54B enhanced the DNA strand-exchange activity of Dmc1 by stabilizing the Dmc1-single-stranded DNA complex.
11884632 Rad54B is a DNA-dependent ATPase and has biochemical properties different from its structural homolog in yeast, Tid1/Rdh54

AA Sequence

MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDLRICSLNLPSE      1 - 70
ESTREINNRDNCSGKYCFEAPTLATLDPPHTVHSAPKEVAVSKEQEEKSDSLVKYFSVVWCKPSKKKHKK     71 - 140
WEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQL    141 - 210
GGGSTAISHSSQVARKCFSNPFKSVCKPSSKENRQNDFQNCKPRHDPYTPNSLVMPRPDKNHQWVFNKNC    211 - 280
FPLVDVVIDPYLVYHLRPHQKEGIIFLYECVMGMRMNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYG    281 - 350
GKPVIKKTLIVTPGSLVNNWKKEFQKWLGSERIKIFTVDQDHKVEEFIKSIFYSVLIISYEMLLRSLDQI    351 - 420
KNIKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPIQNDLQEFFALIDFVNPGILGSLSSYRK    421 - 490
IYEEPIILSREPSASEEEKELGERRAAELTCLTGLFILRRTQEIINKYLPPKIENVVFCRPGALQIELYR    491 - 560
KLLNSQVVRFCLQGLLENSPHLICIGALKKLCNHPCLLFNSIKEKECSSTCDKNEEKSLYKGLLSVFPAD    561 - 630
YNPLLFTEKESGKLQVLSKLLAVIHELRPTEKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQ    631 - 700
QIVDGFNSQHSSFFIFLLSSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKYPVHIYRLLT    701 - 770
TGTIEEKIYQRQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGD    771 - 840
SLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT    841 - 910
//

Text Mined References (40)

PMID Year Title
26431531 2015 The Overexpression of FEN1 and RAD54B May Act as Independent Prognostic Factors of Lung Adenocarcinoma.
26046797 2015 High RAD54B expression: an independent predictor of postoperative distant recurrence in colorectal cancer patients.
25930971 2015 A homozygous mutation in SLC1A4 in siblings with severe intellectual disability and microcephaly.
25765654 2015 RAD54 family translocases counter genotoxic effects of RAD51 in human tumor cells.
25384516 2014 Rad54B serves as a scaffold in the DNA damage response that limits checkpoint strength.
24002644 2013 Synthetic lethal targeting of superoxide dismutase 1 selectively kills RAD54B-deficient colorectal cancer cells.
23876972 2013 Replication study of RAD54B and GREB1 polymorphisms and risk of PCOS in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20687897 2010 Human INO80 chromatin-remodelling complex contributes to DNA double-strand break repair via the expression of Rad54B and XRCC3 genes.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19218431 2009 Specific synthetic lethal killing of RAD54B-deficient human colorectal cancer cells by FEN1 silencing.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
18718930 2008 Biochemical analysis of the N-terminal domain of human RAD54B.
18463164 2008 Rad54B targeting to DNA double-strand break repair sites requires complex formation with S100A11.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17585536 2007 Loss of heterozygosity in the RAD54B region is not predictive for breast carcinomas.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17417655 2007 Homology-driven chromatin remodeling by human RAD54.
17405295 2006 [Analysis of loss of heterozygosity and microsatellite instability RAD52, RAD54 and RAD54B gene and BRCA1 gene mutation in breast cancer].
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17118963 2006 Werner syndrome protein participates in a complex with RAD51, RAD54, RAD54B and ATR in response to ICL-induced replication arrest.
16945962 2006 Stimulation of Dmc1-mediated DNA strand exchange by the human Rad54B protein.
16428451 2006 Differential contributions of mammalian Rad54 paralogs to recombination, DNA damage repair, and meiosis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164066 2004 Human meiotic recombinase Dmc1 promotes ATP-dependent homologous DNA strand exchange.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11884632 2002 Human Rad54B is a double-stranded DNA-dependent ATPase and has biochemical properties different from its structural homolog in yeast, Tid1/Rdh54.
11782437 2002 A role for RAD54B in homologous recombination in human cells.
11181995 2001 The sequence of the human genome.
10851248 2000 A novel human rad54 homologue, Rad54B, associates with Rad51.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10362364 1999 Mutations of a novel human RAD54 homologue, RAD54B, in primary cancer.