Property Summary

NCBI Gene PubMed Count 48
PubMed Score 24.40
PubTator Score 119.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.500 7.1e-03
malignant mesothelioma 1.200 1.0e-05
osteosarcoma -1.428 1.4e-04
non primary Sjogren syndrome sicca -1.300 2.0e-02

Gene RIF (25)

PMID Text
26261251 RAD51C and RAD51D are moderate ovarian cancer susceptibility genes.
26057125 a mutation analysis in 171 high-risk BRCA1 and BRCA2 negative ovarian cancer patients, to evaluate the frequency of hereditary RAD51C and RAD51D variants in Czech population, is reported.
24130102 We aimed to determine the prevalence of germline RAD51D mutations in Spanish breast and ovarian cancer families negative for BRCA1/BRCA2
24088786 endogenous regulation of RAD51D by miR-103/107 was observed in several tumor subtypes; both miR-103 and miR-107 directly target and regulate RAD51 and RAD51D
23372765 Our data provide additional evidence that RAD51D mutations are enriched among ovarian cancer patients, but are extremely rare among familial breast cancer patients.
22986143 loss-of-function mutations in RAD51D predispose to ovarian carcinoma but not to breast carcinoma.
22752287 the contribution of RAD51C and RAD51D gene mutations to an inherited high risk of ovarian cancer is very small
22652533 RAD51D is primarily a moderate penetrance susceptibility gene for ovarian cancer, with clinical significance for the carriers.
22415235 The RAD51D should be included in genetic screening of ovarian cancer families that do not have BRCA1/BRCA2 mutations.
21822267 These data indicate that RAD51D mutation testing may have clinical utility in individuals with ovarian cancer and their families.
21111057 The N-terminal domain of Rad51D is required for the ssDNA-specific binding function of human Rad51D.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20054644 Polymorphisms in RAD51D gene is associated with breast cancer.
19690177 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18058226 The RAD51D E233G variant is not associated with breast cancer.
18058226 Observational study of gene-disease association. (HuGE Navigator)
16717288 Interactions between RAD51D and its XRCC2 and RAD51C partners require a functional RAD51D Walker B ATPase motif, but not motif A.
15170666 Observational study of gene-disease association. (HuGE Navigator)
15170666 E233G single nucleotide polymorphism is a low-penetrance susceptibility gene in the specific subgroup of high-risk familial breast cancer cases that are not related to BRCA1/2.
15109494 Telomere maintenance requires RAD51D.
12975363 RAD51L3 cooperates with Bloom Syndrome Protein during the late stages of homologous recombination processes that serve to restore productive DNA replication at sites of damaged or stalled replication forks
11834724 Homologous pairing and ring and filament structure formation activities of the human Xrcc2*Rad51D complex

AA Sequence

MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGAD      1 - 70
LYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGG     71 - 140
LTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTA    141 - 210
VVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDT    211 - 280
IEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT                          281 - 328
//

Text Mined References (51)

PMID Year Title
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
26057125 2015 Mutation Analysis of the RAD51C and RAD51D Genes in High-Risk Ovarian Cancer Patients and Families from the Czech Republic.
25416956 2014 A proteome-scale map of the human interactome network.
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
24130102 2014 About 1% of the breast and ovarian Spanish families testing negative for BRCA1 and BRCA2 are carriers of RAD51D pathogenic variants.
24088786 2013 Systematic screen identifies miRNAs that target RAD51 and RAD51D to enhance chemosensitivity.
23372765 2013 Analysis of RAD51D in ovarian cancer patients and families with a history of ovarian or breast cancer.
23149936 2013 Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.
22986143 2012 Loss of function germline mutations in RAD51D in women with ovarian carcinoma.
22752287 2012 High sensitivity for BRCA1/2 mutations in breast/ovarian kindreds: are there still other breast/ovary genes to be discovered?
22652533 2012 A Finnish founder mutation in RAD51D: analysis in breast, ovarian, prostate, and colorectal cancer.
22415235 2012 Mutation analysis of RAD51D in non-BRCA1/2 ovarian and breast cancer families.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
21822267 2011 Germline mutations in RAD51D confer susceptibility to ovarian cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21276791 2011 Homologous recombination proteins are associated with centrosomes and are required for mitotic stability.
21111057 2011 Structural and functional characterization of the N-terminal domain of human Rad51D.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20207730 2010 Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.
20189471 2010 The importance of XRCC2 in RAD51-related DNA damage repair.
20054644 2010 Variants in DNA double-strand break repair genes and risk of familial breast cancer in a South American population.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
18058226 2008 The RAD51D E233G variant and breast cancer risk: population-based and clinic-based family studies of Australian women.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16717288 2006 Disparate requirements for the Walker A and B ATPase motifs of human RAD51D in homologous recombination.
16710300 2006 Sws1 is a conserved regulator of homologous recombination in eukaryotic cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16395335 2006 Interplay between human DNA repair proteins at a unique double-strand break in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15170666 2004 The variant E233G of the RAD51D gene could be a low-penetrance allele in high-risk breast cancer families without BRCA1/2 mutations.
15109494 2004 Telomere maintenance requires the RAD51D recombination/repair protein.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975363 2003 Functional interaction between the Bloom's syndrome helicase and the RAD51 paralog, RAD51L3 (RAD51D).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118380 2002 Impaired DNA damage-induced nuclear Rad51 foci formation uniquely characterizes Fanconi anemia group D1.
11842113 2002 Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells.
11842112 2002 Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells.
11834724 2002 Homologous pairing and ring and filament structure formation activities of the human Xrcc2*Rad51D complex.
11751636 2001 Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.
11751635 2001 Identification and purification of two distinct complexes containing the five RAD51 paralogs.
11744692 2002 RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.
10871607 2000 The RAD51 family member, RAD51L3, is a DNA-stimulated ATPase that forms a complex with XRCC2.
10749867 2000 Evidence for simultaneous protein interactions between human Rad51 paralogs.
10092526 1999 Multiple alternative transcripts of the human homologue of the mouse TRAD/R51H3/RAD51D gene, a member of the rec A/RAD51 gene family.
9570954 1998 Identification, characterization, and genetic mapping of Rad51d, a new mouse and human RAD51/RecA-related gene.
9512535 1998 Isolation of novel human and mouse genes of the recA/RAD51 recombination-repair gene family.