Property Summary

NCBI Gene PubMed Count 80
PubMed Score 80.11
PubTator Score 88.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.300 8.0e-04
group 3 medulloblastoma 1.100 5.7e-03
nasopharyngeal carcinoma 1.300 6.0e-05
acute myeloid leukemia -1.400 1.5e-02
ovarian cancer 1.300 2.9e-04

Gene RIF (56)

PMID Text
26740214 RAD51C mutations were identified in 0.5 % of Danish families.
26406419 RAD51C mutation is not associated with high-risk patients from Serbian hereditary breast/ovarian cancer.
26261251 RAD51C and RAD51D are moderate ovarian cancer susceptibility genes.
26057125 a mutation analysis in 171 high-risk BRCA1 and BRCA2 negative ovarian cancer patients, to evaluate the frequency of hereditary RAD51C and RAD51D variants in Czech population, is reported.
25669972 Novel Rad51C splice variants occur in colorectal tumors and cells: Variant 1 without exon-7, Variant 2 without exon 6 and 7 , or Variant 3 without exon 7 and 8. They are associated with FANCD2 foci positive colorectal tumors and microsatellite stability.
25343521 The effect of common single nucleotide polymorphisms (SNPs) in non-coding regions of RAD51C in modulating the risk of breast cancer was investigated.
25292178 Mutations in RAD51C are associated with drug resistance in breast cancer.
25154786 conclude that the woman has two potential disease-causing mutations and that predictive testing of family members should include both the RAD51C and BRCA2 mutation
25086635 RAD51C mutation is associated with breast and ovarian cancer.
24800917 The findings suggest that RAD51C plays a marginal role in breast and ovarian cancer predisposition in Pakistan.
24742710 the Rad51C promoter fragment can be used to transcriptionally target cancer cells.
24631219 Single nucleotide polymorphisms in the Rad51C gene are strongly associated with increased risk for developing head and neck cancer.
24315737 Paralogs of RAD51 might be candidates for genetic risk factors in sporadic squamous cell carcinomas of the head and neck.
24141787 three different cancer susceptibility and FA proteins function in a DNA repair pathway based upon the PALB2 WD40 domain binding to RAD51C and BRCA2.
23810717 The HsRAD51B-HsRAD51C complex plays a role in stabilizing the HsRAD51 nucleoprotein filament during the presynaptic phase of homologous recombination.
23512992 RAD51C-deficient cancer cells are highly sensitive to olaparib and offer preclinical proof-of-principle that RAD51C deficiency may be considered a biomarker for predicting the antitumor effects of olaparib.
23176254 No RAD51C mutations c.837 + 1G > A or c.93delG were detected.
23117857 This study concludes that germline mutations in RAD51C contribute marginally to breast and ovarian cancer susceptibility in ethnically diverse, Jewish high risk families.
23108668 Study observed centrosome defects in the absence of XRCC3. While RAD51B and RAD51C act early in homologous recombination, XRCC3 functions jointly with GEN1 later in the pathway at the stage of Holliday junction resolution.
22843497 We propose that analogous to germline genetic mutations constitutive epimutations in BRCA1 and RAD51C may serve as the first hit of tumor development.
22752287 the contribution of RAD51C and RAD51D gene mutations to an inherited high risk of ovarian cancer is very small
22725699 RAD51C is a susceptibility gene for ovarian and BC.
22476429 RAD51C mutations are rare events among high-risk breast cancer and breast/ovarian cancer families.
22451500 study detected 1.3 percent mutations of RAD51C in breast and ovarian cancer families, while mutations in breast cancer only families seem to be very rare
22370629 RAD51C germline mutations in families with a history for both breast and ovarian cancer appear to have a low prevalence with the exception of some founder mutations.
22167183 unravel the critical role of RAD51C in the FA pathway of ICL repair and as a tumor suppressor.
21990120 Missense variant of RAD51C (p.Gly264Ser) is a moderate penetrance allele in high-risk breast and ovarian cancer families.
21980511 RAD51C is a rare breast and ovarian cancer susceptibility gene.
21750962 RAD51C mutations are implicated in breast and ovarian cancer predisposition.
21616938 These results suggest RAD51C as the first moderate-to-high risk susceptibility gene for ovarian cancer.
21409391 PALB2 mutations are present in a small but substantial proportion of inherited breast cancer cases, and indicates that RAD51C at a population level does not account for a substantial number of familial breast cancer cases
20952512 Reports show RAD51C is a cancer susceptibility gene associated with increased risk of Fanconi anemia-like disorder, breast and ovarian cancer.[Review]
20723205 Data show there was no deleterious RAD51C mutation among the 454 familial breast/ovarian cancer patients.
20723205 Observational study of gene-disease association. (HuGE Navigator)
20697805 Unable to confirm the contribution of the RAD51C gene to hereditary breast and ovarian cancer.
20697805 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20400964 Germline mutations in breast and ovarian cancer pedigrees establish RAD51C as a human cancer susceptibility gene
20400963 biallelic germline mutations in a RAD51 paralog are associated with an FA-like syndrome [case report]
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19451272 RAD51C is required for activation of the checkpoint kinase CHK2 and cell cycle arrest in response to DNA damage.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19064565 Observational study of gene-disease association. (HuGE Navigator)
17114795 the RAD51C-XRCC3-associated Holliday junction resolvase complex associates with crossovers and may play an essential role in the resolution of recombination intermediates prior to chromosome segregation
16395335 RAD51C ensures a tight regulation of RAD51 assembly during DSB repair and plays a direct role in repairing DSBs in vivo.
16215984 Rad51C plays an important role in regulating Rad51 degradation via the ubiquitin-mediated proteasome pathway.
15292210 cellular evidence for the function of human Rad51C in homologous recombinational repair
15170666 Observational study of gene-disease association. (HuGE Navigator)
14716019 concluded that the RAD51 paralogs are involved in Holliday junction processing in human cells
14704354 a fragment of Rad51B containing amino acid residues 1-75 interacts with the C-terminus and linker of Rad51C, residues 79-376, and this region of Rad51C also interacts with mRad51D and Xrcc3
12966089 analysis of protein domains important for functioning of RAD51L2; there is a specific requirement for RAD51L2 in gene conversion in mammalian cells
12427746 Rad51B and Rad51C function through interactions with the human Rad51 recombinase and play a crucial role in the homologous recombinational repair pathway
12036913 Observational study of gene-disease association. (HuGE Navigator)
11744692 This work describes the in vitro and in vivo identification of the RAD51B/RAD51C heterocomplex

AA Sequence

MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLT      1 - 70
NKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAV     71 - 140
DVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYY    141 - 210
FRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAV    211 - 280
ILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTV    281 - 350
VTSACSLQTEGSLSTRKRSRDPEEEL                                                351 - 376
//

Text Mined References (83)

PMID Year Title
26740214 2016 Identification of six pathogenic RAD51C mutations via mutational screening of 1228 Danish individuals with increased risk of hereditary breast and/or ovarian cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26406419 2015 RAD51C mutation screening in high-risk patients from Serbian hereditary breast/ovarian cancer families.
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
26057125 2015 Mutation Analysis of the RAD51C and RAD51D Genes in High-Risk Ovarian Cancer Patients and Families from the Czech Republic.
25669972 2015 Overexpression of Rad51C splice variants in colorectal tumors.
25343521 2014 Single nucleotide polymorphisms in noncoding regions of Rad51C do not change the risk of unselected breast cancer but they modulate the level of oxidative stress and the DNA damage characteristics: a case-control study.
25292178 2015 Enhanced non-homologous end joining contributes toward synthetic lethality of pathological RAD51C mutants with poly (ADP-ribose) polymerase.
25154786 2015 Identification of a breast cancer family double heterozygote for RAD51C and BRCA2 gene mutations.
25086635 2014 RAD51C germline mutations found in Spanish site-specific breast cancer and breast-ovarian cancer families.
24800917 2014 Deleterious RAD51C germline mutations rarely predispose to breast and ovarian cancer in Pakistan.
24742710 2014 Utilization of Rad51C promoter for transcriptional targeting of cancer cells.
24631219 2014 Rad51C: a novel suppressor gene modulates the risk of head and neck cancer.
24315737 2014 RAD51C--a new human cancer susceptibility gene for sporadic squamous cell carcinoma of the head and neck (HNSCC).
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
23810717 2013 The HsRAD51B-HsRAD51C stabilizes the HsRAD51 nucleoprotein filament.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23512992 2013 RAD51C-deficient cancer cells are highly sensitive to the PARP inhibitor olaparib.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23176254 2012 Screening of Finnish RAD51C founder mutations in prostate and colorectal cancer patients.
23149936 2013 Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.
23117857 2012 Germline mutations in RAD51C in Jewish high cancer risk families.
23108668 2013 The RAD51 paralogs ensure cellular protection against mitotic defects and aneuploidy.
22843497 2012 Constitutive promoter methylation of BRCA1 and RAD51C in patients with familial ovarian cancer and early-onset sporadic breast cancer.
22752287 2012 High sensitivity for BRCA1/2 mutations in breast/ovarian kindreds: are there still other breast/ovary genes to be discovered?
22725699 2013 Germline RAD51C mutations in ovarian cancer susceptibility.
22476429 2012 Mutation screening of RAD51C in high-risk breast and ovarian cancer families.
22451500 2012 Predominance of pathogenic missense variants in the RAD51C gene occurring in breast and ovarian cancer families.
22370629 2012 Evaluation of RAD51C as cancer susceptibility gene in a large breast-ovarian cancer patient population referred for genetic testing.
22167183 2012 Distinct roles of FANCO/RAD51C protein in DNA damage signaling and repair: implications for Fanconi anemia and breast cancer susceptibility.
21990120 2012 Analysis of RAD51C germline mutations in high-risk breast and ovarian cancer families and ovarian cancer patients.
21980511 2011 RAD51C germline mutations in breast and ovarian cancer cases from high-risk families.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
21750962 2011 Further evidence for the contribution of the RAD51C gene in hereditary breast and ovarian cancer susceptibility.
21616938 2011 RAD51C is a susceptibility gene for ovarian cancer.
21409391 2011 BRIP1, PALB2, and RAD51C mutation analysis reveals their relative importance as genetic susceptibility factors for breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20952512 2010 RAD51C: a novel cancer susceptibility gene is linked to Fanconi anemia and breast cancer.
20723205 2010 RAD51C germline mutations in breast and ovarian cancer patients.
20697805 2010 Screening RAD51C nucleotide alterations in patients with a family history of breast and ovarian cancer.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20413593 2010 Discovery of a novel function for human Rad51: maintenance of the mitochondrial genome.
20400964 2010 Germline mutations in breast and ovarian cancer pedigrees establish RAD51C as a human cancer susceptibility gene.
20400963 2010 Mutation of the RAD51C gene in a Fanconi anemia-like disorder.
20207730 2010 Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.
19783859 2009 Cellular redistribution of Rad51 in response to DNA damage: novel role for Rad51C.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19451272 2009 RAD51C facilitates checkpoint signaling by promoting CHK2 phosphorylation.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
17114795 2007 Role of RAD51C and XRCC3 in genetic recombination and DNA repair.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16395335 2006 Interplay between human DNA repair proteins at a unique double-strand break in vivo.
16215984 2005 Cellular localization of human Rad51C and regulation of ubiquitin-mediated proteolysis of Rad51.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292210 2004 Human Rad51C deficiency destabilizes XRCC3, impairs recombination, and radiosensitizes S/G2-phase cells.
15170666 2004 The variant E233G of the RAD51D gene could be a low-penetrance allele in high-risk breast cancer families without BRCA1/2 mutations.
14716019 2004 RAD51C is required for Holliday junction processing in mammalian cells.
14704354 2004 Domain mapping of the Rad51 paralog protein complexes.
12975363 2003 Functional interaction between the Bloom's syndrome helicase and the RAD51 paralog, RAD51L3 (RAD51D).
12966089 2003 Identification of functional domains in the RAD51L2 (RAD51C) protein and its requirement for gene conversion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427746 2003 Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.
12118380 2002 Impaired DNA damage-induced nuclear Rad51 foci formation uniquely characterizes Fanconi anemia group D1.
12036913 2002 Effect of germ-line genetic variation on breast cancer survival in a population-based study.
11842113 2002 Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells.
11842112 2002 Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells.
11751636 2001 Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange.
11751635 2001 Identification and purification of two distinct complexes containing the five RAD51 paralogs.
11744692 2002 RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51.
11459987 2001 Complex formation by the human RAD51C and XRCC3 recombination repair proteins.
11410366 2001 Sequence, chromosomal location and expression analysis of the murine homologue of human RAD51L2/RAD51C.
11331762 2001 Homologous-pairing activity of the human DNA-repair proteins Xrcc3.Rad51C.
11034073 2000 17q23 amplifications in breast cancer involve the PAT1, RAD51C, PS6K, and SIGma1B genes.
11034067 2000 Multiple genes at 17q23 undergo amplification and overexpression in breast cancer.
10888877 2000 Gene encoding a new RING-B-box-Coiled-coil protein is mutated in mulibrey nanism.
10749867 2000 Evidence for simultaneous protein interactions between human Rad51 paralogs.
9469824 1998 Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.