Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.13
PubTator Score 11.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 1.900 3.0e-07
glioblastoma 2.600 3.1e-11
posterior fossa group A ependymoma 1.400 1.6e-06
sonic hedgehog group medulloblastoma 3.200 1.3e-09
atypical teratoid/rhabdoid tumor 2.300 9.6e-09
medulloblastoma, large-cell 2.300 7.2e-05
primitive neuroectodermal tumor 2.800 4.2e-06
adrenocortical carcinoma 2.282 2.8e-04
non-small cell lung cancer 2.321 4.7e-23
intraductal papillary-mucinous carcinoma... 2.600 6.2e-04
intraductal papillary-mucinous neoplasm ... 3.400 1.4e-03
lung cancer 3.500 3.6e-06
colon cancer 1.400 6.5e-03
pancreatic cancer 1.600 1.2e-04
breast carcinoma 1.500 1.7e-32
Breast cancer 2.200 4.5e-02
lung adenocarcinoma 1.100 1.5e-07
pediatric high grade glioma 2.600 6.8e-08
primary Sjogren syndrome 1.300 8.0e-03
nasopharyngeal carcinoma 2.200 1.5e-05
psoriasis 1.700 1.6e-12
Endometriosis 1.459 2.5e-02
ductal carcinoma in situ 2.200 3.9e-04
invasive ductal carcinoma 2.400 8.5e-04
ovarian cancer 2.500 7.6e-05

Protein-protein Interaction (9)

Gene RIF (11)

PMID Text
25288561 RAD51AP1 is required for the maintenance of DNA replication fork progression.
22452920 Data suggest that microRNA/mRNA pairs in hsa-miR-140-3p/RAD51AP1/, hsa-miR-145/E2F3, hsa-miR-139-5p/TOP2A, and hsa-miR-133a/GCLC were correlated with ovarian tumorigenesis.
22375013 We have finely mapped the two DNA binding domains in RAD51AP1 and using mutant variants, reveal that both domains are indispensable for RAD51AP1 function in cells.
21903585 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21307306 RAD51AP1 foci colocalize with a subset of DMC1 foci in spermatocytes.
20871616 Although PALB2 alone stimulates D-loop formation, it has a cooperative effect with RAD51AP1, an enhancer of RAD51.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18316552 Enhanced expression of RAD51 associating protein-1 is involved in the growth of intrahepatic cholangiocarcinoma
17996711 RAD51AP1 helps maintain genomic integrity via RAD51 recombinase enhancement.
17996710 RAD51AP1 has a selective affinity for branched-DNA structures that are obligatory intermediates during joint molecule formation.
14966907 expression of three (Beclin 1, RbAp48 and Pir51) were increased and one (aldolase b) was decreased in liver tumor tissues

AA Sequence

MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKR      1 - 70
LPEGTFSIPASAVPCTKMALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSP     71 - 140
HISNCSVASDYLDLDKITVEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDDS    141 - 210
DFCESEDNDEDFSMRKSKVKEIKKKEVKVKSPVEKKEKKSKSKCNALVTSVDSAPAAVKSESQSLPKKVS    211 - 280
LSSDTTRKPLEIRSPSAESKKPKWVPPAASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNAT    281 - 350
ST                                                                        351 - 352
//

Text Mined References (29)

PMID Year Title
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
25416956 2014 A proteome-scale map of the human interactome network.
25288561 2014 RAD51AP1-deficiency in vertebrate cells impairs DNA replication.
23754376 2013 FIGNL1-containing protein complex is required for efficient homologous recombination repair.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22452920 2012 Identifying microRNA/mRNA dysregulations in ovarian cancer.
22375013 2012 Mechanistic insights into RAD51-associated protein 1 (RAD51AP1) action in homologous DNA repair.
21903585 2011 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21307306 2011 Molecular basis for enhancement of the meiotic DMC1 recombinase by RAD51 associated protein 1 (RAD51AP1).
21269460 2011 Initial characterization of the human central proteome.
20871616 2010 Enhancement of RAD51 recombinase activity by the tumor suppressor PALB2.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18316552 2008 Enhanced expression of RAD51 associating protein-1 is involved in the growth of intrahepatic cholangiocarcinoma cells.
17996711 2007 Promotion of homologous recombination and genomic stability by RAD51AP1 via RAD51 recombinase enhancement.
17996710 2007 RAD51AP1 is a structure-specific DNA binding protein that stimulates joint molecule formation during RAD51-mediated homologous recombination.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16990250 2006 RAD51AP2, a novel vertebrate- and meiotic-specific protein, shares a conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966907 2004 Genes encoding Pir51, Beclin 1, RbAp48 and aldolase b are up or down-regulated in human primary hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9396801 1997 A novel nucleic acid-binding protein that interacts with human rad51 recombinase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.