Property Summary

NCBI Gene PubMed Count 173
PubMed Score 23.79
PubTator Score 220.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ovarian cancer 1.300 2.5e-03
atypical teratoid / rhabdoid tumor 1.200 4.1e-06
glioblastoma -1.300 4.0e-04
intraductal papillary-mucinous adenoma (... 1.400 1.4e-03
intraductal papillary-mucinous carcinoma... 1.400 1.5e-03
lung cancer 1.200 3.4e-02
osteosarcoma -1.173 4.9e-03
Pick disease -1.300 4.3e-04
progressive supranuclear palsy -1.500 5.6e-03
psoriasis -2.400 2.4e-05

Protein-protein Interaction (2)

Gene RIF (130)

AA Sequence

MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDP      1 - 70
KVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREM     71 - 140
ISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMEL    141 - 210
KYLKQYKEKACEIRDQITSKEAQLTSSKEIVKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALDSRKK    211 - 280
QMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQ    281 - 350
GRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAE    351 - 420
KETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILELDQELIKAERELSK    421 - 490
AEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEMLTKDKADKDEQIRKIKSRHS    491 - 560
DELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASSEQNKNHINNELKRKEEQLSSYEDKLF    561 - 630
DVCGSQDFESDLDRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISD    631 - 700
LQSKLRLAPDKLKSTESELKKKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEE    701 - 770
QETLLGTIMPEEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLD    771 - 840
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQSLYREIKDAKE    841 - 910
QVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKDIENYIQDGKDDYKKQKETEL    911 - 980
NKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQDNLTLRKRNEELKEVEEERKQHLKEMGQMQV    981 - 1050
LQMKSEHQKLEENIDNIKRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKD   1051 - 1120
LDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLK   1121 - 1190
GDTALDMRGRCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQR   1191 - 1260
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH                     1261 - 1312
//

Text Mined References (184)

PMID Year Title