Property Summary

NCBI Gene PubMed Count 85
PubMed Score 88.57
PubTator Score 62.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
interstitial lung disease -1.700 1.8e-02
Waldenstrons macroglobulinemia 1.033 1.8e-02
Multiple myeloma 1.558 3.5e-03
osteosarcoma 1.205 3.0e-05
hereditary spastic paraplegia -1.217 4.9e-02
tuberculosis and treatment for 6 months 1.400 1.3e-05
lung cancer 1.400 8.2e-03
Breast cancer 3.000 2.5e-02
group 3 medulloblastoma 1.200 3.9e-03
lung adenocarcinoma 2.298 2.9e-05
ovarian cancer 2.400 4.1e-05
dermatomyositis -1.300 1.3e-02

Gene RIF (50)

PMID Text
26170451 Data show that nucleotide excision repair factor XPC-RAD23B is a target of poly(ADP-ribosyl)ation catalyzed by poly(ADP-ribose) polymerase 1 (PARP1).
25311859 Data indicate that phosphorylation provides a mechanism to regulate Rad23/proteasome interaction.
24897598 RAD23B has a potential role in breast cancer progression and a tumor suppressor role of nuclear RAD23B in breast cancer.
24643114 It is unlikely that the RAD23B 249Val/Val polymorphism may contribute to the individual susceptibility to cancer risk.
23776089 Polymorphism in RAD23B gene is associated with breast cancer.
23703321 Results define a regulatory mechanism that involves the interplay between HR23B and HDAC6 that influences the biological outcome of HDAC inhibitor treatment.
22915658 HR23B expression was associated with disease stabilization for patients with unresectable hepatocellular carcinoma treated with epigenetic therapy using belinostat, a histone deacetylase inhibitor.
22575648 PNGase-PUB serves not only as p97-binding module but also as a possible activator of HR23 in endoplasmic reticulum-associated degradation mechanisms.
22004425 Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus.
20575039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies RAD23 homolog B (RAD23B) is important for HIV-1 replication
20150366 Observational study of gene-disease association. (HuGE Navigator)
19878615 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19740755 BRG1 stimulates the recruitment of XPG and PCNA to successfully culminate the nucleotide excision repair.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19538122 XPC subunit interaction with DNA is stimulated by endogenous HR23B.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19444904 Genetic polymorphisms in RAD23B is associated with Laryngeal cancer risk associated with smoking and alcohol consumption.
19270000 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19182904 26S proteasomes and p97/VCP complexes bind to the ubiquitin-like domain of HHR23B.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18709642 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18708406 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18574675 Fluorescence correlation spectroscopy of the binding of nucleotide excision repair protein XPC-HHR23B with DNA substrates is reported.
17932354 Observational study of gene-disease association. (HuGE Navigator)
17728339 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16712842 determined that hHR23A and hHR23B could be co-purified with unique proteolytic and stress-responsive factors from human breast cancer tissues, indicating that they have unique functions in vivo
16537713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16399771 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16253613 intracellular distribution hHR23B is cell cycle dependent
15885096 Results describe the solution structure of a protein fragment containing amino acids 275-342 of hHR23B and compare it with the previously reported solution structures of the corresponding domain of hHR23A.
15849729 Observational study of gene-disease association. (HuGE Navigator)
15550378 the human nucleotide excision repair gene, hHR23B, is epigenetically silenced in interleukin-6-responsive multiple myeloma KAS-6/1 cells
15064313 Highly expressed in the human testis and in ejaculated spermatozoa. This novel alternative splicing form of RAD23B is correlated with human spermatogenesis.
14645509 hHR23 binds to polyubiquitylated p53 via its carboxyl-terminal ubiquitin-associated (Uba) domain shielding p53 from deubiquitylation
14585839 structure of the ubiquitin-interacting motif of the proteasome subunit S5a bound to the ubiquitin-like domain of HR23B
12815074 analysis of mHR23A/B double-mutant cells showed that HR23 proteins function in nucleotide excision repair by governing xeroderma pigmentosum group C protein stability via partial protection against proteasomal degradation
12215374 Gene expression of RAD23B was down-regulated during early apoptosis in human hepatoma cells exposed to Paeoniae Radix extract in vitro.

AA Sequence

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFV      1 - 70
VVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPA     71 - 140
SAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAA    141 - 210
LRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLR    211 - 280
NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIA    281 - 350
EAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED               351 - 409
//

Text Mined References (104)

PMID Year Title
26170451 2015 Poly(ADP-ribose) Polymerase 1 Modulates Interaction of the Nucleotide Excision Repair Factor XPC-RAD23B with DNA via Poly(ADP-ribosyl)ation.
25416956 2014 A proteome-scale map of the human interactome network.
25311859 2014 Rad23 interaction with the proteasome is regulated by phosphorylation of its ubiquitin-like (UbL) domain.
24897598 2014 Identification and functional validation of RAD23B as a potential protein in human breast cancer progression.
24643114 2014 The association between RAD23B Ala249Val polymorphism and cancer susceptibility: evidence from a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23776089 2013 Genetic polymorphisms in RAD23B and XPC modulate DNA repair capacity and breast cancer risk in Puerto Rican women.
23703321 2013 A regulatory circuit that involves HR23B and HDAC6 governs the biological response to HDAC inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023329 2012 Genome-wide association study in Chinese men identifies two new prostate cancer risk loci at 9q31.2 and 19q13.4.
22915658 2012 Epigenetic therapy using belinostat for patients with unresectable hepatocellular carcinoma: a multicenter phase I/II study with biomarker and pharmacokinetic analysis of tumors from patients in the Mayo Phase II Consortium and the Cancer Therapeutics Research Group.
22575648 2012 NMR characterization of the interaction between the PUB domain of peptide:N-glycanase and ubiquitin-like domain of HR23.
22004425 2012 Genetic risk of hepatocellular carcinoma in patients with hepatitis C virus: a case control study.
21962512 2011 A DNA repair complex functions as an Oct4/Sox2 coactivator in embryonic stem cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20798892 2010 Stimulation of DNA Glycosylase Activities by XPC Protein Complex: Roles of Protein-Protein Interactions.
20575039 2010 XPC genetic polymorphisms correlate with the response to imatinib treatment in patients with chronic phase chronic myeloid leukemia.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20059542 2010 Cross-species divergence of the major recognition pathways of ubiquitylated substrates for ubiquitin/26S proteasome-mediated proteolysis.
20028083 2010 Photo-cross-linking of XPC-Rad23B to cisplatin-damaged DNA reveals contacts with both strands of the DNA duplex and spans the DNA adduct.
19941824 2009 Two-step recognition of DNA damage for mammalian nucleotide excision repair: Directional binding of the XPC complex and DNA strand scanning.
19878615 2010 Modulation of nucleotide excision repair in human lymphocytes by genetic and dietary factors.
19740755 2009 Modulation of nucleotide excision repair by mammalian SWI/SNF chromatin-remodeling complex.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19538122 2009 Photoactivated DNA analogs of substrates of the nucleotide excision repair system and their interaction with proteins of NER-competent HeLa cell extract.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19444904 2009 Laryngeal cancer risk associated with smoking and alcohol consumption is modified by genetic polymorphisms in ERCC5, ERCC6 and RAD23B but not by polymorphisms in five other nucleotide excision repair genes.
19435460 2009 Variably modulated gating of the 26S proteasome by ATP and polyubiquitin.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19182904 2009 Isolation of mammalian 26S proteasomes and p97/VCP complexes using the ubiquitin-like domain from HHR23B reveals novel proteasome-associated proteins.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124519 2009 DNA repair gene variants associated with benign breast disease in high cancer risk women.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18709642 2008 Nucleotide excision repair genes and risk of lung cancer among San Francisco Bay Area Latinos and African Americans.
18708406 2008 Variants of DNA repair genes and the risk of biliary tract cancers and stones: a population-based study in China.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18574675 2008 Fluorescence correlation spectroscopy of the binding of nucleotide excision repair protein XPC-hHr23B with DNA substrates.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932354 2007 Mutagen sensitivity and genetic variants in nucleotide excision repair pathway: genotype-phenotype correlation.
17728339 2007 High-order interactions among genetic polymorphisms in nucleotide excision repair pathway genes and smoking in modulating bladder cancer risk.
17662948 2007 Regulation of Pax3 by proteasomal degradation of monoubiquitinated protein in skeletal muscle progenitors.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16990800 2006 A novel proteasome interacting protein recruits the deubiquitinating enzyme UCH37 to 26S proteasomes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16712842 2006 Evidence for distinct functions for human DNA repair factors hHR23A and hHR23B.
16537713 2006 Genetic variation in the nucleotide excision repair pathway and bladder cancer risk.
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16399771 2006 Polymorphisms in nucleotide excision repair genes, smoking and breast cancer in African Americans and whites: a population-based case-control study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16253613 2005 Studies on the intracellular localization of hHR23B.
15964821 2005 Centrin 2 stimulates nucleotide excision repair by interacting with xeroderma pigmentosum group C protein.
15885096 2005 Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B.
15866714 2005 Recombinant expression of maize nucleotide excision repair protein Rad23 in Escherichia coli.
15849729 2005 Polymorphisms in the DNA nucleotide excision repair genes and lung cancer risk in Xuan Wei, China.
15550378 2005 Epigenetic silencing of the human nucleotide excision repair gene, hHR23B, in interleukin-6-responsive multiple myeloma KAS-6/1 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358861 2004 A complex between peptide:N-glycanase and two proteasome-linked proteins suggests a mechanism for the degradation of misfolded glycoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15064313 Expression of a novel RAD23B mRNA splice variant in the human testis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645509 2003 Involvement of the DNA repair protein hHR23 in p53 degradation.
14585839 2004 Structure of the ubiquitin-interacting motif of S5a bound to the ubiquitin-like domain of HR23B.
12832454 2003 Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a.
12815074 2003 A novel regulation mechanism of DNA repair by damage-induced and RAD23-dependent stabilization of xeroderma pigmentosum group C protein.
12547395 2003 DNA bending by the human damage recognition complex XPC-HR23B.
12509299 2002 A molecular mechanism for DNA damage recognition by the xeroderma pigmentosum group C protein complex.
12509233 2002 The carboxy-terminal domain of the XPC protein plays a crucial role in nucleotide excision repair through interactions with transcription factor IIH.
12505994 2003 Xeroderma pigmentosum group C protein interacts physically and functionally with thymine DNA glycosylase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215374 2002 Paeoniae Radix, a Chinese herbal extract, inhibit hepatoma cells growth by inducing apoptosis in a p53 independent pathway.
11827521 2002 Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.
11562482 2001 Identification of proteins that interact with mammalian peptide:N-glycanase and implicate this hydrolase in the proteasome-dependent pathway for protein degradation.
11279143 2001 Centrosome protein centrin 2/caltractin 1 is part of the xeroderma pigmentosum group C complex that initiates global genome nucleotide excision repair.
11259578 2001 Strong functional interactions of TFIIH with XPC and XPG in human DNA nucleotide excision repair, without a preassembled repairosome.
10915768 2000 Ataxin-3, the MJD1 gene product, interacts with the two human homologs of yeast DNA repair protein RAD23, HHR23A and HHR23B.
10873465 2000 Stable binding of human XPC complex to irradiated DNA confers strong discrimination for damaged sites.
10854423 2000 3-Methyladenine-DNA glycosylase (MPG protein) interacts with human RAD23 proteins.
10734143 2000 The xeroderma pigmentosum group C protein complex XPC-HR23B plays an important role in the recruitment of transcription factor IIH to damaged DNA.
10583946 1999 Quality control by DNA repair.
10488153 1999 Interaction of hHR23 with S5a. The ubiquitin-like domain of hHR23 mediates interaction with S5a subunit of 26 S proteasome.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
9734359 1998 Xeroderma pigmentosum group C protein complex is the initiator of global genome nucleotide excision repair.
9372924 1997 Two human homologs of Rad23 are functionally interchangeable in complex formation and stimulation of XPC repair activity.
8692695 1996 XPC and human homologs of RAD23: intracellular localization and relationship to other nucleotide excision repair complexes.
8168482 1994 Purification and cloning of a nucleotide excision repair complex involving the xeroderma pigmentosum group C protein and a human homologue of yeast RAD23.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7851894 1994 Chromosomal localization of three repair genes: the xeroderma pigmentosum group C gene and two human homologs of yeast RAD23.