Property Summary

NCBI Gene PubMed Count 56
PubMed Score 111.42
PubTator Score 68.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2844 1.1e-11
group 3 medulloblastoma 2254 6.3e-04
ovarian cancer 8491 6.5e-04
lung cancer 4473 9.8e-04
colon cancer 1475 3.2e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.417 1.7
Bloom syndrome 30 3.027 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 6.3e-04
colon cancer -1.400 3.2e-02
lung cancer 2.000 9.8e-04
lung carcinoma 1.100 1.1e-11
ovarian cancer 1.500 6.5e-04

Protein-protein Interaction (4)

Gene RIF (23)

PMID Text
25650659 Authors show that BRCA1 and RAD17 genes, whose derived proteins play a pivotal role in DNA damage repair, are transcriptional targets of gain-of-function mutant p53 proteins.
24971543 These data suggest that v-Src attenuates ATR-Chk1 signaling through the inhibition of Rad17-Rad9 interaction.
24923443 USP20 and Rad17 interact, and that this interaction is enhanced by UV exposure. We show that USP20 regulation of Rad17 is at the protein level in a proteasome-dependent manner. USP20 depletion results in poor activation of Chk1 protein by phosphorylation
24534091 Rad17 is phosphorylated by ATM at Thr622 resulting in a direct interaction of Rad17 with NBS1, facilitating recruitment of MRE11, RAD50 and ATM to the DNA double-strand breaks.
23687379 Our data suggest RAD17 as a novel target protein for gemcitabine combination therapy supplementing or complementing inhibition of CHK1.
23684611 Knockdown of Rad17 with two independent siRNAs significantly reduced Chk1 phosphorylation and substantial RPA32 Ser33 phosphorylation.
23637229 Data indicate that regulation of Rad17 turnover is through the Cdh1/anaphase-promoting complex pathway in breast cancer cells.
23383325 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
20424596 Proteolysis of Rad17 by Cdh1/APC regulates checkpoint termination and recovery from genotoxic stress
19275579 Rad17 is required for HIV-1 Vpr-mediated G2 arrest in Rad17-specific siRNA-transfected cells
18950845 Observational study of gene-disease association. (HuGE Navigator)
18378394 hRAD17 delayed growth of NIH3T3 fibroblasts transformed by the H-ras oncogene in nude mice.
17657792 Loss of hRAD17 expression occurs frequently in HNSCC, is often due to genomic deletion, and may facilitate genomic instability in HNSCC
16951182 Using siRNA to knock down Rad17 demonstrates that it is not essntial for the DNA replication checkpoint in Hela cells.
16885023 Findings reveal a phosphorylation-dependent function of Rad17 in an ATR-Rad17-Claspin-Chk1-signaling cascade that responds to specific replication stress.
16354571 Rad17 is required for HIV-1 Vpr-mediated G2 arrest in Rad17-specific siRNA-transfected cells
15538388 interacts with newly identified hMCM7 protein, a core component of the DNA replication apparatus
15485898 we show a requirement for Rad17 and Hus1 to induce G(2) arrest as well as Vpr-induced phosphorylation of histone 2A variant X (H2AX) and formation of nuclear foci containing H2AX and breast cancer susceptibility protein 1
15485898 Rad17 is required for HIV-1 Vpr-mediated G2 arrest in Rad17-specific siRNA-transfected cells
14605214 replication protein A (RPA) stimulates the binding of the Rad17-Rfc2-5 complex to single-stranded DNA
14500819 Rad17 localizes to DNA replication sites and interacts with DNA polymerase epsilon.
12400013 upon replication block a Rad17/RF-C complex is recruited to sites of DNA lesions in late S phase, binds the Rad9/Hus1/Rad1 complex and enables it to interact with PCNA. An interaction of Rad17/RF-C with PCNA is mediated by the small RF-C p37 subunit
11602352 The four alternatively spliced forms differentially expressed in different tissues, in different phases of the cell cycle, and differentially responded to X-irradiation.

AA Sequence

MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLS      1 - 70
SLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQGGSILLITGPPG     71 - 140
CGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQ    141 - 210
MLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEEC    211 - 280
SISNISFNPVAPTIMMKFLNRIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENN    281 - 350
LRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLP    351 - 420
SHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLL    421 - 490
REYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQ    491 - 560
LLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLG    561 - 630
EPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT                       631 - 681
//

Text Mined References (61)

PMID Year Title
25650659 2015 Gain of function mutant p53 proteins cooperate with E2F4 to transcriptionally downregulate RAD17 and BRCA1 gene expression.
24971543 2014 v-Src inhibits the interaction between Rad17 and Rad9 and induces replication fork collapse.
24923443 2014 Ubiquitin-specific peptidase 20 regulates Rad17 stability, checkpoint kinase 1 phosphorylation and DNA repair by homologous recombination.
24534091 2014 Rad17 recruits the MRE11-RAD50-NBS1 complex to regulate the cellular response to DNA double-strand breaks.
23687379 2013 Depletion of RAD17 sensitizes pancreatic cancer cells to gemcitabine.
23684611 2013 Two distinct modes of ATR activation orchestrated by Rad17 and Nbs1.
23637229 2013 Regulation of Rad17 protein turnover unveils an impact of Rad17-APC cascade in breast carcinogenesis and treatment.
23383325 2013 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21269460 2011 Initial characterization of the human central proteome.
20424596 2010 Proteolysis of Rad17 by Cdh1/APC regulates checkpoint termination and recovery from genotoxic stress.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18378394 2008 The human homolog of fission yeast Rad17 is implicated in tumor growth.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17657792 2008 Downregulation of RAD17 in head and neck cancer.
16951182 2006 Chk1- and claspin-dependent but ATR/ATM- and Rad17-independent DNA replication checkpoint response in HeLa cells.
16885023 2006 Rad17 phosphorylation is required for claspin recruitment and Chk1 activation in response to replication stress.
16381901 2006 The LIFEdb database in 2006.
16314342 2006 DNA damage checkpoints in mammals.
15538388 2004 Interaction between human MCM7 and Rad17 proteins is required for replication checkpoint signaling.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485898 2004 Human immunodeficiency virus type 1 Vpr-mediated G2 arrest requires Rad17 and Hus1 and induces nuclear BRCA1 and gamma-H2AX focus formation.
15235112 2004 Chromatin association of rad17 is required for an ataxia telangiectasia and rad-related kinase-mediated S-phase checkpoint in response to low-dose ultraviolet radiation.
15149599 2004 Telomere shortening triggers senescence of human cells through a pathway involving ATM, p53, and p21(CIP1), but not p16(INK4a).
14871926 2004 Requirement of protein phosphatase 5 in DNA-damage-induced ATM activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
14624239 2003 Biochemical characterization of DNA damage checkpoint complexes: clamp loader and clamp complexes with specificity for 5' recessed DNA.
14611806 2003 Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.
14605214 2003 Replication protein A-mediated recruitment and activation of Rad17 complexes.
14500819 2003 The human checkpoint Rad protein Rad17 is chromatin-associated throughout the cell cycle, localizes to DNA replication sites, and interacts with DNA polymerase epsilon.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12672690 2003 Genomic instability and endoreduplication triggered by RAD17 deletion.
12578958 2003 Loading of the human 9-1-1 checkpoint complex onto DNA by the checkpoint clamp loader hRad17-replication factor C complex in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12400013 2002 Colocalization of human Rad17 and PCNA in late S phase of the cell cycle upon replication block.
11907025 2002 Structures of the human Rad17-replication factor C and checkpoint Rad 9-1-1 complexes visualized by glycerol spray/low voltage microscopy.
11799063 2002 Regulation of ATR substrate selection by Rad17-dependent loading of Rad9 complexes onto chromatin.
11715513 1999 [Human hR24L gene is involved in DNA excision repair and recombination repair].
11687627 2001 Phosphorylation of serines 635 and 645 of human Rad17 is cell cycle regulated and is required for G(1)/S checkpoint activation in response to DNA damage.
11602352 2001 Multiple alternative splicing forms of human RAD17 and their differential response to ionizing radiation.
11572977 2001 Purification and characterization of human DNA damage checkpoint Rad complexes.
11418864 2001 ATR/ATM-mediated phosphorylation of human Rad17 is required for genotoxic stress responses.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10884395 2000 The human checkpoint protein hRad17 interacts with the PCNA-like proteins hRad1, hHus1, and hRad9.
10852904 2000 Retention of the human Rad9 checkpoint complex in extraction-resistant nuclear complexes after DNA damage.
10608806 1999 Substrate specificities and identification of putative substrates of ATM kinase family members.
10593953 1999 HRad17 colocalizes with NHP2L1 in the nucleolus and redistributes after UV irradiation.
10480350 Human and mouse RAD17 genes: identification, localization, genomic structure and histological expression pattern in normal testis and seminoma.
10232579 1999 HRad17, a human homologue of the Schizosaccharomyces pombe checkpoint gene rad17, is overexpressed in colon carcinoma.
10208430 1999 hRAD17, a structural homolog of the Schizosaccharomyces pombe RAD17 cell cycle checkpoint gene, stimulates p53 accumulation.
9933569 1999 Human and mouse homologs of the Schizosaccharomyces pombe rad17+ cell cycle checkpoint control gene.
9878245 1998 cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster.
9869296 1998 The mammalian Rad24 homologous to yeast Saccharomyces cerevisiae Rad24 and Schizosaccharomyces pombe Rad17 is involved in DNA damage checkpoint.
9716408 1998 Human and mouse homologs of Schizosaccharomyces pombe rad1(+) and Saccharomyces cerevisiae RAD17: linkage to checkpoint control and mammalian meiosis.
9660800 1998 Identification of a human homologue of the Schizosaccharomyces pombe rad17+ checkpoint gene.
1563350 1992 DNA repair mutants defining G2 checkpoint pathways in Schizosaccharomyces pombe.