Property Summary

NCBI Gene PubMed Count 57
PubMed Score 78.35
PubTator Score 105.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 3.0e-02
invasive ductal carcinoma 1.100 5.8e-03
osteosarcoma 2.326 1.1e-04
ovarian cancer 1.100 8.3e-04
pituitary cancer 1.100 1.2e-04
psoriasis 1.600 2.0e-04
tuberculosis and treatment for 6 months -1.400 1.8e-04

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF      1 - 70
QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE     71 - 140
ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM    141 - 210
EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES    211 - 280
ES                                                                        281 - 282
//

Text Mined References (59)

PMID Year Title