Property Summary

NCBI Gene PubMed Count 228
PubMed Score 437.95
PubTator Score 273.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.200 3.7e-27
atypical teratoid / rhabdoid tumor 1.500 2.9e-09
cystic fibrosis -1.500 1.3e-04
diabetes mellitus -1.200 1.8e-03
glioblastoma 1.100 9.8e-08
group 3 medulloblastoma 1.300 9.5e-05
intraductal papillary-mucinous carcinoma... 1.100 7.7e-04
intraductal papillary-mucinous neoplasm ... -1.500 1.3e-03
lung cancer 1.100 1.8e-03
medulloblastoma, large-cell 1.900 2.8e-06
Multiple myeloma 2.347 1.9e-04
oligodendroglioma 1.300 1.0e-16
osteosarcoma -1.515 1.0e-03
ovarian cancer -1.500 1.4e-04
pediatric high grade glioma 1.200 4.4e-07
primitive neuroectodermal tumor 1.300 8.5e-07
psoriasis -1.600 2.8e-04
Waldenstrons macroglobulinemia 1.581 6.3e-04

Protein-protein Interaction (5)

PDB (10)

Gene RIF (158)

AA Sequence

MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVV      1 - 70
ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKY     71 - 140
TVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASG    141 - 210
GKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSK    211 - 280
AEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR                                     281 - 317
//

Text Mined References (247)

PMID Year Title