Property Summary

NCBI Gene PubMed Count 86
PubMed Score 52.96
PubTator Score 60.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624330 confirmatory 2057 / 1883 / 338351 Discovery of small molecule inhibitors of the oncogenic and cytokinetic protein MgcRacGAP - Primary and Confirmatory Screens
624334 summary 0 / 0 / 0 of small molecule inhibitors of the oncogenic and cytokinetic protein MgcRacGAP - Summary
652142 other 0 / 0 / 2362 Biochemical MgcRacGAP assay detecting GTPase activation of the target GTPase Rac1 through the measurement of inorganic phosphate.
652153 confirmatory 4 / 0 / 43 Biochemical RhoGAP selectivity assay - MgcRacGAP inhibition

Gene RIF (38)

PMID Text
26508373 RACGAP1 expression levels in the nucleus and cytoplasm, determined by immunohistochemical staining, predict opposite clinical outcomes and that both could be independent prognostic markers for colorectal cancer.
26018753 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma
25568185 High RacGAP1 expression was an independent predictive marker for lymph node metastasis, recurrence and poor prognosis in colorectal cancer patients.
25486482 central spindle assembly and 2 Plk1-dependent phosphorylations are required to establish efficient binding of the Ect2 BRCT in early cytokinesis.
25475728 RacGAP1 mediated endothelial barrier function loss and melanoma transmigration in a focal adhesion-dependent manner.RacGAP1 activation mediates focal adhesion assembly and actin stress fiber formation.
25305482 HCV viral protein NS5B polymerase activity was significantly reduced by silencing RacGAP1 and, vice versa, was increased by overexpression of RacGAP1 in a cell-based reporter assay.
24857844 We show that some are new substrates of the anaphase-promoting complex/cyclosome and validate KIFC1 and RacGAP1/Cyk4 as two such targets involved respectively in timely mitotic spindle disassembly and cell spreading
24807907 MgcRacGAP colocalizes with CGN and CGNL1 at TJs and forms a complex and interacts directly in vitro with CGN and CGNL1.
24615626 RacGAP1 expression at the invasive front in gastric cancer was significantly correlated with factors reflecting tumor progression and poor prognosis.RACGAP1 gene expression in diffuse type gastric cancer was elevated.
23696789 APC(CDH1) targets MgcRacGAP for destruction in the late M phase.
23665020 The crystal structure of the GAP domain of MgcRacGAP has been determined at a resolution of 1.9A; MgcRacGAP (residues 348-546) exists as a monomer in solution.
23525949 High expression of RACGAP1 is associated with meningiomas.
23225332 RACGAP1 and MCRS1 overexpression in nonsmall-cell lung cancer.RACGAP1 and MCRS1 may be cancer-related genes in NSCLC.
23135572 In untreated patients, Ki67, TOP2A, and RacGAP1 are significant and independent prognostic markers.
23096218 High RACGAP1 mRNA expression (above the median) was associated with poor disease-free survival and overall survival in high risk early breast cancer
22945935 MKlp1-CYK4 centralspindlin complex is a guanosine triphosphatase-activating protein (GAP) for Rac1 and not RhoA.
22683270 several Rho family small GTPases activate PI3K by an indirect cooperative positive feedback that required a combination of Rac, CDC42, and RhoG small GTPase activities
21825042 the level of RACGAP1 expression is sufficient to predict the early recurrence of HCC.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of Rac GTPase activating protein 1 (RACGAP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19015243 study reports that mitotic complex genes Ect2, RacGAP, and MKLP1 are coordinately induced in S phase in proliferating T lymphocytes as well as in epithelial cells, depending upon activity of the CUX1 and E2F1 transcription factors
18511905 Study demonstrates that FIP3 and ECT2 form mutually exclusive complexes with Cyk-4 and that dissociation of ECT2 from the mid-body at late telophase may be required for the recruitment of FIP3 and recycling endosomes to the cleavage furrow.
18201571 report here that (i) MgcRacGAP is phosphorylated by Aurora B and Cdk1, (ii) PP2A dephosphorylates Aurora B and Cdk1 phosphorylated sites and (iii) inhibition of PP2A abrogates MgcRacGAP/Ect2 interaction
17982282 These findings demonstrate that HIF-1alpha function is negatively affected by its interaction with MgcRacGAP.
16790497 This study defines a cellular mechanism that links centralspindlin to Cep55, which, in turn, controls the midbody structure and membrane fusion at the terminal stage of cytokinesis.
16129829 MgcRacGAP controls the initiation of cytokinesis by regulating ECT2, which in turn induces the assembly of the contractile ring and triggers the ingression of the cleavage furrow
16118207 Cdk1 inactivation is sufficient to activate a signaling pathway leading to cytokinesis, which emanates from mitotic spindles and is regulated by ECT2, MgcRacGAP, and RhoA
15872091 activation of Vav1-Rac signaling pathway by CXCL12 represents an important inside-out event controlling efficient up-regulation of alpha4beta1-dependent T lymphocyte adhesion
15863513 beta 2 chimerin has a role in rac-GAP-dependent inhibition of breast cancer cell proliferation
15728185 intracellular Ca2+ is mobilized by sphingosine 1 phosphate and mediates rac activation and adherens junction assembly in endothelial cells
15677464 H-Ras-specific activation of Rac-MKK3/6-p38 pathway has a role in invasion and migration of breast epithelial cells
15642749 MgcRacGAP regulates the activation and function of Cdc42 in mitosis.
15284113 data reveal an important role for MgcRacGAP in STAT3 activation, and demonstrate that MgcRacGAP regulates IL-6-induced cellular differentiation in which STAT3 plays a pivotal role
14729465 Expression of a GTPase-activating protein (GAP)-deficient mutant (R386A) of MgcRacGAP induces abnormal cortical activity during cytokinesis in U2OS cells. Multiple large blebs were observed in cells expressing MgcRacGAP R386A.
12493759 This enzyme is down-regulated by estradiol.
11937491 The plexin-B1/Rac interaction inhibits PAK activation and enhances Sema4D ligand binding
11782313 MKLP1 interacts with CYK4, a GTPase activating protein for the Rho GTPase, to form the centralspindlin complex. Centralspindlin is a key regulator of Rho function and microtubule organisation during cytokinesis, and is essential for cell division.

AA Sequence

MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV      1 - 70
KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN     71 - 140
KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ    141 - 210
GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS    211 - 280
NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM    281 - 350
LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS    351 - 420
LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK    421 - 490
MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN    491 - 560
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM    561 - 630
LK                                                                        631 - 632
//

Text Mined References (93)

PMID Year Title
27185834 2016 Diaphanous formin mDia2 regulates CENP-A levels at centromeres.
26778597 2016 Expression of aurora kinase A correlates with the Wnt-modulator RACGAP1 in gastric cancer.
26602080 2015 MgcRacGAP inhibition stimulates JAK-dependent STAT3 activity.
26508373 2016 Opposing prognostic roles of nuclear and cytoplasmic RACGAP1 expression in colorectal cancer patients.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26252513 2015 The RhoGAP activity of CYK-4/MgcRacGAP functions non-canonically by promoting RhoA activation during cytokinesis.
26018753 2015 RacGAP1 Is a Novel Downstream Effector of E2F7-Dependent Resistance to Doxorubicin and Is Prognostic for Overall Survival in Squamous Cell Carcinoma.
25947135 2015 MgcRacGAP restricts active RhoA at the cytokinetic furrow and both RhoA and Rac1 at cell-cell junctions in epithelial cells.
25875822 2015 CYK4 promotes antiparallel microtubule bundling by optimizing MKLP1 neck conformation.
25568185 2015 RacGAP1 expression, increasing tumor malignant potential, as a predictive biomarker for lymph node metastasis and poor prognosis in colorectal cancer.
25486482 2014 Centralspindlin assembly and 2 phosphorylations on MgcRacGAP by Polo-like kinase 1 initiate Ect2 binding in early cytokinesis.
25475728 2015 RacGAP1-driven focal adhesion formation promotes melanoma transendothelial migration through mediating adherens junction disassembly.
25416956 2014 A proteome-scale map of the human interactome network.
25305482 2014 RacGTPase-activating protein 1 interacts with hepatitis C virus polymerase NS5B to regulate viral replication.
25074804 2014 Coronin-1C and RCC2 guide mesenchymal migration by trafficking Rac1 and controlling GEF exposure.
25068414 2014 Crystal structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4.
24857844 2014 Using in vivo biotinylated ubiquitin to describe a mitotic exit ubiquitome from human cells.
24807907 2014 MgcRacGAP interacts with cingulin and paracingulin to regulate Rac1 activation and development of the tight junction barrier during epithelial junction assembly.
24615626 2015 Clinical significance of RacGAP1 expression at the invasive front of gastric cancer.
23696789 2013 APC(CDH1) targets MgcRacGAP for destruction in the late M phase.
23665020 2013 Crystal structure of GTPase-activating domain from human MgcRacGAP.
23525949 2013 Expression of RACGAP1 in high grade meningiomas: a potential role in cancer progression.
23235882 2012 Centralspindlin links the mitotic spindle to the plasma membrane during cytokinesis.
23225332 2013 Analysis of 20 genes at chromosome band 12q13: RACGAP1 and MCRS1 overexpression in nonsmall-cell lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135572 2013 Validity of the proliferation markers Ki67, TOP2A, and RacGAP1 in molecular subgroups of breast cancer.
23096218 2013 Prognostic significance of RACGAP1 mRNA expression in high-risk early breast cancer: a study in primary tumors of breast cancer patients participating in a randomized Hellenic Cooperative Oncology Group trial.
22945935 2012 CYK4 inhibits Rac1-dependent PAK1 and ARHGEF7 effector pathways during cytokinesis.
22927365 2012 Centralspindlin: at the heart of cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683270 2012 Cooperative activation of PI3K by Ras and Rho family small GTPases.
22580824 2012 ARF6 GTPase protects the post-mitotic midbody from 14-3-3-mediated disintegration.
21825042 2011 Upregulation of Rac GTPase-activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19468302 2009 Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
19468300 2009 Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056985 2008 Inhibition of Rac by the GAP activity of centralspindlin is essential for cytokinesis.
19015243 2009 CUX1 and E2F1 regulate coordinated expression of the mitotic complex genes Ect2, MgcRacGAP, and MKLP1 in S phase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18511905 2008 Sequential Cyk-4 binding to ECT2 and FIP3 regulates cleavage furrow ingression and abscission during cytokinesis.
18201571 2008 Phosphoregulation of MgcRacGAP in mitosis involves Aurora B and Cdk1 protein kinases and the PP2A phosphatase.
17982282 2007 MgcRacGAP interacts with HIF-1alpha and regulates its transcriptional activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16790497 2006 Cep55, a microtubule-bundling protein, associates with centralspindlin to control the midbody integrity and cell abscission during cytokinesis.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236794 2006 Dissecting the role of Rho-mediated signaling in contractile ring formation.
16129829 2005 MgcRacGAP controls the assembly of the contractile ring and the initiation of cytokinesis.
16118207 2005 Inhibition of cyclin-dependent kinase 1 induces cytokinesis without chromosome segregation in an ECT2 and MgcRacGAP-dependent manner.
16103226 2005 An ECT2-centralspindlin complex regulates the localization and function of RhoA.
15872091 2005 Vav1 and Rac control chemokine-promoted T lymphocyte adhesion mediated by the integrin alpha4beta1.
15863513 2005 Rac-GAP-dependent inhibition of breast cancer cell proliferation by {beta}2-chimerin.
15728185 2005 Sphingosine 1-phosphate-induced mobilization of intracellular Ca2+ mediates rac activation and adherens junction assembly in endothelial cells.
15677464 2005 H-Ras-specific activation of Rac-MKK3/6-p38 pathway: its critical role in invasion and migration of breast epithelial cells.
15642749 2005 Ect2 and MgcRacGAP regulate the activation and function of Cdc42 in mitosis.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15284113 2004 A GTPase-activating protein binds STAT3 and is required for IL-6-induced STAT3 activation and for differentiation of a leukemic cell line.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14744859 2004 Human mitotic spindle-associated protein PRC1 inhibits MgcRacGAP activity toward Cdc42 during the metaphase.
14729465 2004 MgcRacGAP regulates cortical activity through RhoA during cytokinesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12689593 2003 Phosphorylation by aurora B converts MgcRacGAP to a RhoGAP during cytokinesis.
12590651 2003 Rho family GTPase Rnd2 interacts and co-localizes with MgcRacGAP in male germ cells.
12493759 2003 Down-regulation of Rac-1 GTPase by Estrogen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432077 2002 Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.
11942621 2001 Role of MgcRacGAP/Cyk4 as a regulator of the small GTPase Rho family in cytokinesis and cell differentiation.
11937491 2002 The plexin-B1/Rac interaction inhibits PAK activation and enhances Sema4D ligand binding.
11782313 2002 Central spindle assembly and cytokinesis require a kinesin-like protein/RhoGAP complex with microtubule bundling activity.
11278976 2001 Tat1, a novel sulfate transporter specifically expressed in human male germ cells and potentially linked to rhogtpase signaling.
11278894 2001 Phorbol esters and related analogs regulate the subcellular localization of beta 2-chimaerin, a non-protein kinase C phorbol ester receptor.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11085985 2001 MgcRacGAP is involved in cytokinesis through associating with mitotic spindle and midbody.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10979956 2000 MgcRacGAP is involved in the control of growth and differentiation of hematopoietic cells.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10748082 2000 Control of intramolecular interactions between the pleckstrin homology and Dbl homology domains of Vav and Sos1 regulates Rac binding.
10655059 2000 A genome-wide survey of RAS transformation targets.
9822598 1998 PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia.
9497316 1998 MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.