Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1.49
PubTator Score 76.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.500 1.3e-03
atypical teratoid / rhabdoid tumor -1.200 2.4e-03
group 3 medulloblastoma 1.500 3.9e-02
invasive ductal carcinoma 1.200 1.0e-03

Gene RIF (18)

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP     71 - 140
QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF                      141 - 192
//

Text Mined References (35)

PMID Year Title