Property Summary

NCBI Gene PubMed Count 30
PubMed Score 1.49
PubTator Score 76.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.4e-03
adult high grade glioma -1.500 1.3e-03
group 3 medulloblastoma 1.500 3.9e-02
invasive ductal carcinoma 1.200 1.0e-03

Gene RIF (16)

PMID Text
26469953 RAC3 is an inhibitor of senescence whose downregulation in aged individuals could be probably a tumor suppressor mechanism.
25854406 Efficient silencing of Rac3 strongly inhibited A549 cell proliferation.
24684802 Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation.
23388133 Report role of Rac3 in breast cancer aggressiveness and show the potential usefulness of Rac3 depletion in breast cancer therapy.
22957814 Hypoxia inhibits the RAC3 gene expression leading to the autophagy process, allowing tumor cells to survive until angiogenesis occurs
22918955 Rac1b forms a complex with NADPH oxidase and promotes the production of reactive oxygen species, expression of Snail, and activation of the epithelial-mesenchymal transition program.
22786680 Activation of epithelial-mesenchymal transition by MMP-induced expression of Rac1b gave rise to lung adenocarcinoma.
22370642 RAC3 bound tightly to the ARE enhancer region of the HO-1 promoter via Nrf2 binding.
21852230 Rac3 GTPase has a role in the regulation of autophagy
21217774 RAC3 is a novel ERalpha co-activator that promotes cell migration and has prognostic value for ERalpha-positive breast cancer metastasis.
19494130 Rac3 inhibits adhesion and differentiation of neuronal cells by modifying GIT1 downstream signaling.
18319303 Data demonstrate that Rac3 shares with Rac1 the ability to interfere with cadherin-mediated adhesion.
17244648 RAC1 and RAC3 have opposing functions in cell adhesion and differentiation in neuronal cells.
16280046 results suggest a role for both the Rac1 and Rac3 GTPases in human breast cancer progression
16027728 functional analysis of Rac1 and Rac3 using RNA interference reveals a critical role for these GTPases in the invasive behavior of glioma and breast carcinoma cells
15993075 Our data is the first report of the frequency of Rac3 overexpression and mutation in human brain tumors. Overexpression may be associated with aggressive tumor behavior

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP     71 - 140
QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF                      141 - 192
//

Text Mined References (33)

PMID Year Title
26469953 2015 RAC3 more than a nuclear receptor coactivator: a key inhibitor of senescence that is downregulated in aging.
25854406 2015 Silencing of Rac3 inhibits proliferation and induces apoptosis of human lung cancer cells.
24684802 2014 F-box protein complex FBXL19 regulates TGF?1-induced E-cadherin down-regulation by mediating Rac3 ubiquitination and degradation.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23388133 2013 Rac3 induces a molecular pathway triggering breast cancer cell aggressiveness: differences in MDA-MB-231 and MCF-7 breast cancer cell lines.
22957814 2012 Nuclear receptor coactivator RAC3 inhibits autophagy.
22918955 2012 Matrix compliance regulates Rac1b localization, NADPH oxidase assembly, and epithelial-mesenchymal transition.
22786680 2012 Matrix metalloproteinase induction of Rac1b, a key effector of lung cancer progression.
22370642 2013 The nuclear cofactor RAC3/AIB1/SRC-3 enhances Nrf2 signaling by interacting with transactivation domains.
21852230 2011 A role for Rac3 GTPase in the regulation of autophagy.
21269460 2011 Initial characterization of the human central proteome.
21217774 2011 RAC3 is a pro-migratory co-activator of ER?.
19494130 2009 Rac3 inhibits adhesion and differentiation of neuronal cells by modifying GIT1 downstream signaling.
18319303 2008 PAK is required for the disruption of E-cadherin adhesion by the small GTPase Rac.
17244648 2007 Rac1 and Rac3 have opposing functions in cell adhesion and differentiation of neuronal cells.
16982419 2006 The Rac activator DOCK7 regulates neuronal polarity through local phosphorylation of stathmin/Op18.
16525025 2006 Rac3-induced neuritogenesis requires binding to Neurabin I.
16280046 2005 Rac1 and Rac3 isoform activation is involved in the invasive and metastatic phenotype of human breast cancer cells.
16027728 2005 Roles of the Rac1 and Rac3 GTPases in human tumor cell invasion.
15993075 2005 Expression of Rac3 in human brain tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956649 2002 Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain.
11756406 2002 The small GTPase Rac3 interacts with the integrin-binding protein CIB and promotes integrin alpha(IIb)beta(3)-mediated adhesion and spreading.
10894930 2000 The small GTPase RAC3 gene is located within chromosome band 17q25.3 outside and telomeric of a region commonly deleted in breast and ovarian tumours.
10777539 2000 Transcriptional activation by hepatocyte nuclear factor-1 requires synergism between multiple coactivator proteins.
10618392 2000 Endogenous, hyperactive Rac3 controls proliferation of breast cancer cells by a p21-activated kinase-dependent pathway.
9852280 1998 Identification of a novel Rac3-interacting protein C1D.
9299243 1997 Structure and chromosomal assignment to 22q12 and 17qter of the ras-related Rac2 and Rac3 human genes.
9252344 1997 Characterization of RAC3, a novel member of the Rho family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2674130 1989 rac, a novel ras-related family of proteins that are botulinum toxin substrates.