Property Summary

NCBI Gene PubMed Count 100
PubMed Score 669.79
PubTator Score 218.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis 1.299 9.0e-03
adult high grade glioma 1.300 2.9e-03
Astrocytoma, Pilocytic 1.100 3.6e-05
chronic kidney disease 1.100 1.7e-02
cutaneous lupus erythematosus 2.400 4.2e-04
cystic fibrosis 1.861 1.8e-06
ductal carcinoma in situ 1.100 3.0e-02
glioblastoma 1.200 1.9e-04
interstitial cystitis 1.700 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.9e-02
invasive ductal carcinoma 1.246 5.6e-03
lung cancer -1.500 5.9e-04
lung carcinoma -2.200 2.1e-31
malignant mesothelioma -1.300 1.5e-06
osteosarcoma -2.860 1.0e-03
ovarian cancer -2.400 1.9e-09
pancreatic cancer 1.500 1.3e-04
periodontitis 1.100 8.5e-30
posterior fossa group A ependymoma 1.100 2.1e-05
primary pancreatic ductal adenocarcinoma 1.394 8.7e-04
primary Sjogren syndrome 3.000 1.0e-04
psoriasis 1.200 9.2e-03
Waldenstrons macroglobulinemia 1.080 6.3e-04

Protein-protein Interaction (4)

Gene RIF (55)

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYP     71 - 140
QGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL                      141 - 192
//

Text Mined References (105)

PMID Year Title