Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.67
PubTator Score 5.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.413 1.7

Expression

Gene RIF (3)

AA Sequence

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTI      1 - 70
LVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINV     71 - 140
TQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQ    141 - 210
EQSSSIETPSEEAASPHS                                                        211 - 228
//

Text Mined References (14)

PMID Year Title