Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.67
PubTator Score 3.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTI      1 - 70
LVDFWDTAGQERFQSMHASYYHKAHACIMVFDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINV     71 - 140
TQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQ    141 - 210
EQSSSIETPSEEVASPHS                                                        211 - 228
//

Text Mined References (10)

PMID Year Title