Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.57
PubTator Score 18.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 1.5e-02
ependymoma -1.300 3.0e-03
oligodendroglioma -1.100 4.8e-03
psoriasis 1.700 3.2e-04
atypical teratoid / rhabdoid tumor -1.100 4.0e-05
medulloblastoma, large-cell -1.200 3.1e-03
lung cancer 1.700 2.1e-03
Breast cancer 1.200 5.4e-18
ductal carcinoma in situ 1.100 7.0e-03
invasive ductal carcinoma 1.600 1.1e-04

Gene RIF (3)

PMID Text
22495352 The expression levels of cellular Mss4 mRNA and protein are rapidly changed in response to a broad range of extracellular stress stimuli.
19536175 Observational study of gene-disease association. (HuGE Navigator)
12105226 MSS4 modulates Rab15 activity in early endocytosis

AA Sequence

MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL      1 - 70
VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE                      71 - 123
//

Text Mined References (21)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22495352 2012 Mss4 protein is a regulator of stress response and apoptosis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
16541104 2006 Nucleotide exchange via local protein unfolding--structure of Rab8 in complex with MSS4.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105226 2002 Mammalian suppressor of Sec4 modulates the inhibitory effect of Rab15 during early endocytosis.
10094488 1999 Identification of novel interaction partners for the conserved membrane proximal region of alpha-integrin cytoplasmic domains.
9441742 1997 Cloning of novel transcripts of the human guanine-nucleotide-exchange factor Mss4: in situ chromosomal mapping and expression in pancreatic cancer.
9013620 1997 An evolutionarily conserved domain in a subfamily of Rabs is crucial for the interaction with the guanyl nucleotide exchange factor Mss4.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7651540 1995 Structure of guanine-nucleotide-exchange factor human Mss4 and identification of its Rab-interacting surface.
7619808 1995 Cloning, Zn2+ binding, and structural characterization of the guanine nucleotide exchange factor human Mss4.