Property Summary

NCBI Gene PubMed Count 35
PubMed Score 20.45
PubTator Score 53.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

Gene RIF (17)

PMID Text
26430212 The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner.
26002576 RABEX-5 is a potential useful indicator and predicts a poor long-term prognosis for small cell lung cancer(SCLC), which should be considered in defining the prognosis with other well-known prognosticators in C-SCLC patients
25427001 Expression of RABEX-5 is significantly higher in gastric cancer tissues and is associated with tumor size and lymph node metastasis.
24957337 analysis of Rabex-5 GEF activation by Rabaptin-5
24716822 RABEX-5 mRNA expression is a strong predictor of poor prognosis in prostate cancer patients treated by radical prostatectomy.
24714377 This implies that Rap regulates endothelial barrier function by dual control of cytoskeletal tension. The molecular details of the signaling pathways are becoming to be elucidated
23048039 Interaction of Rabex-5 with Rab5 depends on interaction of the MIU domain with the ubiquitinated L1 to drive its internalization.
22952906 KCa2.3 is localized to a caveolin-rich domain within the plasma membrane and is endocytosed in a dynamin- and Rab5-dependent manner.
22846990 a novel mechanistic insight into how Rabex-5 regulates internalization and postendocytic trafficking of ubiquitinated L1 destined for lysosomal degradation.
21500550 RABEX-5 and RAB5 may be involved in the development of breast cancer metastasis.
20655225 functions as an E3 ligase for Ras
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18160707 Integration of TGFB and RAS signaling silences RABGEF1 and enhances growth factor-directed cell migration.
17450153 crystal structure of the RABEX-5 catalytic core in complex with nucleotide-free RAB21, a key intermediate in the exchange reaction pathway
17341663 Fc epsilon RI-mediated mast cell functional activation is dependent on RabGEF1's GEF activity
16499958 Here, we report that Rabex-5, a guanine nucleotide exchange factor for Rab5, binds to ubiquitin through two independent ubiquitin binding domains
12505986 GGAs, a family of Arf-dependent clathrin adaptors involved in selection of TGN cargo, interact with the Rabaptin-5-Rabex-5 complex, a Rab4/Rab5 effector regulating endosome fusion

AA Sequence

MVVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQERCAEFPALRGPPTQGACSSCVQ      1 - 70
RGPVLCHRAPPGAAGEHAATEGREGAPSVSGTHALLQRPLGADCGDRPAACGPAEGPLCQAQVVSRKKMS     71 - 140
LKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERVLLCCPGWSAMV    141 - 210
QFQLTATSASWAQVILLLQPPKWLGLQKLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVK    211 - 280
KFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRD    281 - 350
LSIEEQSECAQDFYHNVAERMQTRGKERRFHHVGQAGLELLTSGDPPASASQSAGNTGVEPPHPAVPPER    351 - 420
VEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAIT    421 - 490
DIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCN    491 - 560
PSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKN    561 - 630
LDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPP    631 - 700
LQPQVYAG                                                                  701 - 708
//

Text Mined References (43)

PMID Year Title
26430212 2015 Rabaptin5 is recruited to endosomes by Rab4 and Rabex5 to regulate endosome maturation.
26002576 2015 Elevated RABEX-5 protein expression predicts poor prognosis in combined small cell lung cancer.
25427001 2014 RABEX-5 is upregulated and plays an oncogenic role in gastric cancer development by activating the VEGF signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24957337 2014 Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5.
24716822 2014 Expression of RABEX-5 and its clinical significance in prostate cancer.
24714377 2014 Rap1 signaling in endothelial barrier control.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382462 2013 RabGEFs are a major determinant for specific Rab membrane targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23048039 2012 Spatiotemporal regulation of the ubiquitinated cargo-binding activity of Rabex-5 in the endocytic pathway.
22952906 2012 Dynamin- and Rab5-dependent endocytosis of a Ca2+ -activated K+ channel, KCa2.3.
22846990 2012 Rabex-5 protein regulates the endocytic trafficking pathway of ubiquitinated neural cell adhesion molecule L1.
21500550 2011 [The expression and clinical significance of RABEX-5 and RAB5 in breast cancer].
21223598 2011 Genome-wide joint SNP and CNV analysis of aortic root diameter in African Americans: the HyperGEN study.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20655225 2010 Feedback regulation of Ras signaling by Rabex-5-mediated ubiquitination.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18160707 2008 Integration of transforming growth factor beta and RAS signaling silences a RAB5 guanine nucleotide exchange factor and enhances growth factor-directed cell migration.
18088087 2008 Phosphoproteome of resting human platelets.
17450153 2007 Structural basis for Rab GTPase activation by VPS9 domain exchange factors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17341663 2007 Roles of RabGEF1/Rabex-5 domains in regulating Fc epsilon RI surface expression and Fc epsilon RI-dependent responses in mast cells.
16499958 2006 Crystal structure of the ubiquitin binding domains of rabex-5 reveals two modes of interaction with ubiquitin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15339665 2004 Structure, exchange determinants, and family-wide rab specificity of the tandem helical bundle and Vps9 domains of Rabex-5.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12505986 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11452015 2001 Functional synergy between Rab5 effector Rabaptin-5 and exchange factor Rabex-5 when physically associated in a complex.
11098082 2000 Seven genes that are differentially transcribed in colorectal tumor cell lines.
9323142 1997 A novel Rab5 GDP/GTP exchange factor complexed to Rabaptin-5 links nucleotide exchange to effector recruitment and function.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.