Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.86
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 2.000 2.3e-05
glioblastoma multiforme 1.100 7.7e-15
osteosarcoma 1.617 8.2e-08
medulloblastoma, large-cell 1.100 1.2e-05
pancreatic ductal adenocarcinoma liver m... 1.150 3.0e-03
lung cancer 1.800 1.9e-03
non primary Sjogren syndrome sicca 1.100 2.6e-02
subependymal giant cell astrocytoma 2.053 6.8e-03
ductal carcinoma in situ 1.400 1.9e-04
invasive ductal carcinoma 1.200 1.3e-02
ovarian cancer 3.100 1.8e-09

Gene RIF (2)

PMID Text
17254320 FRA-1 expression, including its intracellular localization, may be considered a useful marker for hyperplastic and neoplastic proliferative breast disorders
17205062 Pyk2 regulation is associated with increased expression of Fra-1 and JunD, activator protein-1 transcription factors known to be required for involucrin expression.

AA Sequence

MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAE      1 - 70
AVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEK     71 - 140
QMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPL    141 - 210
EELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLP    211 - 280
PPGYQLVPDTQWEQLQTEGRQLQKDLESVSRERDELQEGLRRSNEDCAKQMQVLLAQVQNSEQLLRTLQG    281 - 350
TVSQAQERVQLQMAELVTTHKCLHHEVKRLNEENQGLRAEQLPSSAPQGSQQEQGEEESLPSSVPELQQL    351 - 420
LCCTRQEARARLQAQEHGAERLRIEIVTLREALEEETVARASLEGQLRVQREETEVLEASLCSLRTEMER    421 - 490
VQQEQSKAQLPDLLSEQRAKVLRLQAELETSEQVQRDFVRLSQALQVRLERIRQAETLEQVRSIMDEAPL    491 - 560
TDVRDIKDT                                                                 561 - 569
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
17254320 2007 FRA-1 protein overexpression is a feature of hyperplastic and neoplastic breast disorders.
17205062 2007 The role of proline-rich protein tyrosine kinase 2 in differentiation-dependent signaling in human epidermal keratinocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9524116 1998 Two distinct effectors of the small GTPase Rab5 cooperate in endocytic membrane fusion.