Property Summary

NCBI Gene PubMed Count 34
PubMed Score 31.95
PubTator Score 37.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.100 6.4e-05
Gaucher disease type 1 -1.100 9.9e-03
glioblastoma -1.100 1.9e-03
hereditary spastic paraplegia -1.111 2.0e-02
intraductal papillary-mucinous adenoma (... 1.200 1.6e-03
osteosarcoma -1.707 8.9e-04
ovarian cancer -2.500 1.9e-09
pancreatic ductal adenocarcinoma liver m... -1.568 5.4e-03
pediatric high grade glioma -1.100 4.3e-04
psoriasis -1.400 4.0e-03

Gene RIF (11)

AA Sequence

MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDD      1 - 70
LGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQER     71 - 140
TQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIK    141 - 210
ELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTW    211 - 280
QKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVC    281 - 350
ALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSK    351 - 420
ALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLL    421 - 490
SSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKL    491 - 560
QLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAV    561 - 630
LMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEE    631 - 700
KLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLE    701 - 770
SLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADS    771 - 840
LERIRAILNDTKLTDINQLPET                                                    841 - 862
//

Text Mined References (54)

PMID Year Title