Property Summary

NCBI Gene PubMed Count 32
PubMed Score 31.41
PubTator Score 37.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.400 4.0e-03
osteosarcoma -2.499 1.2e-08
glioblastoma -1.100 1.9e-03
hereditary spastic paraplegia -1.111 2.0e-02
pancreatic ductal adenocarcinoma liver m... -1.568 5.4e-03
intraductal papillary-mucinous adenoma (... 1.200 1.6e-03
pediatric high grade glioma -1.100 4.3e-04
inflammatory breast cancer -1.100 4.1e-02
ovarian cancer -2.500 1.9e-09
Gaucher disease type 3 -1.200 3.8e-03

Gene RIF (10)

PMID Text
26680696 The pleckstrin homology domain (PH) of PLD1 itself promotes degradation of HIF-1alpha, then accelerates EGFR endocytosis via upregulation of rabaptin-5 and suppresses tumor progression.
26633357 ITSN2L interacts with RABEP1 and stimulates its degradation in regulation of endocytosis.
26430212 The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner.
25496667 Genome-wide shRNA screening identifies RABEP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24957337 analysis of Rabex-5 GEF activation by Rabaptin-5
22975325 The disruption of Rabaptin-5 Ser407 phosphorylation reduces persistent cell migration in 2D and alphavbeta3-dependent invasion.
22841712 Silencing of Rabaptin-5 induces down-regulation of recycling of K(V)10.1 channel in transfected cells and reduction of K(V)10.1 current density in cells natively expressing K(V)10.1, indicating a role of Rabaptin-5 in channel trafficking.
21271679 Breast cancer cell line studies showed that microRNA, miR-373, was capable of promoting breast cancer invasion and metastasis via translational inhibition of TXNIP and RABEP1 that were the direct target genes of miR-373.
19500109 The authors determined that increased listeriolysin O-independent dissolution of vacuoles during RABEP1 knockdown required the Listeria monocytogenes broad-range phospholipase C (PC-PLC).
12505986 GGAs, a family of Arf-dependent clathrin adaptors involved in selection of TGN cargo, interact with the Rabaptin-5-Rabex-5 complex, a Rab4/Rab5 effector regulating endosome fusion

AA Sequence

MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDD      1 - 70
LGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQER     71 - 140
TQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIK    141 - 210
ELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTW    211 - 280
QKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVC    281 - 350
ALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSK    351 - 420
ALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLL    421 - 490
SSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKL    491 - 560
QLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAV    561 - 630
LMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEE    631 - 700
KLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLE    701 - 770
SLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADS    771 - 840
LERIRAILNDTKLTDINQLPET                                                    841 - 862
//

Text Mined References (51)

PMID Year Title
26680696 2015 The pleckstrin homology domain of phospholipase D1 accelerates EGFR endocytosis by increasing the expression of the Rab5 effector, rabaptin-5.
26633357 2015 ITSN2L Interacts with and Negatively Regulates RABEP1.
26430212 2015 Rabaptin5 is recruited to endosomes by Rab4 and Rabex5 to regulate endosome maturation.
24957337 2014 Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22975325 2012 PKD controls ?v?3 integrin recycling and tumor cell invasive migration through its substrate Rabaptin-5.
22841712 2012 Physical and functional interaction of KV10.1 with Rabaptin-5 impacts ion channel trafficking.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21271679 2011 Global identification of miR-373-regulated genes in breast cancer by quantitative proteomics.
21269460 2011 Initial characterization of the human central proteome.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19500109 2009 Perturbation of vacuolar maturation promotes listeriolysin O-independent vacuolar escape during Listeria monocytogenes infection of human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16407276 2006 The Rab5 guanine nucleotide exchange factor Rabex-5 binds ubiquitin (Ub) and functions as a Ub ligase through an atypical Ub-interacting motif and a zinc finger domain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15457209 2004 Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
15378032 2004 Structural basis of Rab5-Rabaptin5 interaction in endocytosis.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15143060 2004 The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637142 2003 Crystal structure of nitrile hydratase from a thermophilic Bacillus smithii.
12773381 2003 Rabaptin-5alpha/rabaptin-4 serves as a linker between rab4 and gamma(1)-adaptin in membrane recycling from endosomes.
12505986 2003 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788822 2002 Divalent Rab effectors regulate the sub-compartmental organization and sorting of early endosomes.
11718716 2001 Identification of rabaptin-5, rabex-5, and GM130 as putative effectors of rab33b, a regulator of retrograde traffic between the Golgi apparatus and ER.
11452015 2001 Functional synergy between Rab5 effector Rabaptin-5 and exchange factor Rabex-5 when physically associated in a complex.
11387476 2001 Binding of GGA2 to the lysosomal enzyme sorting motif of the mannose 6-phosphate receptor.
11129044 2000 The MAK-V protein kinase regulates endocytosis in mouse.
10747088 2000 A family of proteins with gamma-adaptin and VHS domains that facilitate trafficking between the trans-Golgi network and the vacuole/lysosome.
10698684 2000 Rabaptin4, a novel effector of the small GTPase rab4a, is recruited to perinuclear recycling vesicles.
10608812 1999 Human rabaptin-5 is selectively cleaved by caspase-3 during apoptosis.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9742146 1998 The neuronal growth-associated protein GAP-43 interacts with rabaptin-5 and participates in endocytosis.
9524117 1998 Distinct Rab-binding domains mediate the interaction of Rabaptin-5 with GTP-bound Rab4 and Rab5.
9323142 1997 A novel Rab5 GDP/GTP exchange factor complexed to Rabaptin-5 links nucleotide exchange to effector recruitment and function.
9321397 1997 Cleavage of rabaptin-5 blocks endosome fusion during apoptosis.
9045618 1997 The tuberous sclerosis 2 gene product, tuberin, functions as a Rab5 GTPase activating protein (GAP) in modulating endocytosis.
8521472 1995 Rabaptin-5 is a direct effector of the small GTPase Rab5 in endocytic membrane fusion.