Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.52
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 1.2e-02
atypical teratoid / rhabdoid tumor -2.400 3.0e-06
ependymoma -2.000 1.8e-02
glioblastoma -1.500 2.0e-03
medulloblastoma, large-cell -2.600 3.1e-06
pediatric high grade glioma -1.100 2.3e-03
psoriasis -1.300 4.1e-46
subependymal giant cell astrocytoma -1.514 4.8e-02

Protein-protein Interaction (9)

Gene RIF (3)

AA Sequence

MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK      1 - 70
SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT     71 - 140
WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC             141 - 201
//

Text Mined References (13)

PMID Year Title