Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.52
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 1.2e-02
ependymoma -2.000 1.8e-02
atypical teratoid / rhabdoid tumor -2.400 3.0e-06
glioblastoma -1.500 2.0e-03
medulloblastoma, large-cell -2.600 3.1e-06
pediatric high grade glioma -1.100 2.3e-03
subependymal giant cell astrocytoma -1.514 4.8e-02
psoriasis -1.300 4.1e-46

 GO Function (2)

Protein-protein Interaction (9)

Gene RIF (3)

PMID Text
20459747 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells
20012524 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells
16140752 HIV-1 Gag co-localizes with Rab7-, Rab9-, and LAMP1-containing membranes at cytoplasmic and juxtanuclear sites in Staufen1-depleted cells

AA Sequence

MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFK      1 - 70
SLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQT     71 - 140
WCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC             141 - 201
//

Text Mined References (13)

PMID Year Title
22637480 2012 RUTBC2 protein, a Rab9A effector and GTPase-activating protein for Rab36.
21255211 2011 Rab GTPases regulating phagosome maturation are differentially recruited to mycobacterial phagosomes.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20048159 2010 Assembly of the biogenesis of lysosome-related organelles complex-3 (BLOC-3) and its interaction with Rab9.
19490898 2009 RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204133 2005 Prediction of regulatory modules comprising microRNAs and target genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051767 2002 Intracellular membrane trafficking pathways in bone-resorbing osteoclasts revealed by cloning and subcellular localization studies of small GTP-binding rab proteins.
11043518 2000 cDNA cloning of a new member of the Ras superfamily, RAB9-like, on the human chromosome Xq22.1-q22.3 region.