Property Summary

NCBI Gene PubMed Count 40
PubMed Score 7.82
PubTator Score 49.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 2.3e-03
malignant mesothelioma -1.200 2.4e-06
medulloblastoma, large-cell -1.200 3.8e-05
Multiple myeloma 1.402 1.2e-02
ovarian cancer -1.700 1.4e-05
spina bifida -1.505 4.1e-02

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (23)

AA Sequence

MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR      1 - 70
SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA     71 - 140
WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC             141 - 201
//

Text Mined References (50)

PMID Year Title